DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and Zfp956

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_006236479.1 Gene:Zfp956 / 312301 RGDID:1304879 Length:573 Species:Rattus norvegicus


Alignment Length:404 Identity:88/404 - (21%)
Similarity:142/404 - (35%) Gaps:120/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QSGAPENQ-----VHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQK---QTLQA 147
            |.|:||:.     .|:|.   ::.:::.   .|::.:.:....:....|.::::.:|   :|..|
  Rat   142 QEGSPEDWQKELCKHVAK---ERREVLG---SLETGQLESAPSVLPWIKQEEEVCEKSLQETTSA 200

  Fly   148 KL------------QEGNIDGPPESFTLH--PRKR-------------TCRTEEQADMIPKEATR 185
            .|            .||....|..|:...  |.|.             .|| |.:|..:|:.:  
  Rat   201 SLCSETWLANKKRTLEGMSLAPEPSWVTEGGPGKEDFSEQGTCGDLLPVCR-EREASSLPRGS-- 262

  Fly   186 STKMICDADG-----YYNCPHCSKRF--------------CSQTQLRTHITDLCNR--------- 222
            .::.:..|:|     .:|....||:.              |.|:..: .:|...||         
  Rat   263 QSQSVSAAEGTENGQNFNVQELSKQLEYSHHGSQPFASLQCPQSAAQ-QVTLTRNRRAPAAQRAY 326

  Fly   223 -CPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVF 286
             |..|.::::.:|.|..|.|.|..:..:||..|.|.|.|...|..|.|||..:.|..|:||...|
  Rat   327 TCVQCGKSFVHQSTLTTHYRTHTGEKPYKCAECEKRFGRLSTLLEHQRTHTGERPFPCAQCGRRF 391

  Fly   287 IEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICD 351
            .....|..|||.|...                                          ||.| |.
  Rat   392 GRLSTLVEHRRTHTGE------------------------------------------KPFP-CT 413

  Fly   352 ICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGD-LFRCEFCSLVFVD 415
            .|.|:|:.:..|..|...|:.:|.. :||.|...|..:....||.|.|..: .|.|..|...|..
  Rat   414 QCDKRFTRLANLTVHQSVHSGEHAF-QCTQCGSCFTHKPSFLRHLRSHSQEKRFTCGQCGKSFTC 477

  Fly   416 VNYLRKHK-KRIHS 428
            .::|.:|: ...||
  Rat   478 RSWLVRHQSSHAHS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 24/73 (33%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
zf-C2H2 249..271 CDD:278523 9/21 (43%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 5/21 (24%)
Zfp956XP_006236479.1 C2H2 Zn finger 302..320 CDD:275368 5/18 (28%)
zf-C2H2 326..348 CDD:395048 6/21 (29%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
zf-H2C2_2 341..365 CDD:404364 9/23 (39%)
C2H2 Zn finger 356..376 CDD:275368 8/19 (42%)
COG5048 380..>445 CDD:227381 24/108 (22%)
C2H2 Zn finger 384..404 CDD:275368 8/19 (42%)
zf-H2C2_2 397..421 CDD:404364 12/66 (18%)
C2H2 Zn finger 412..432 CDD:275368 6/19 (32%)
C2H2 Zn finger 440..460 CDD:275368 7/19 (37%)
zf-H2C2_2 455..477 CDD:404364 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.