DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG11398

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:299 Identity:75/299 - (25%)
Similarity:107/299 - (35%) Gaps:95/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DDDLS-QKQTLQ-------AKLQEGNIDGPPESFTLHPRKRTC-----RTEEQADMIPK------ 181
            |::|| ..:.||       ::.|:|   |.| ||..    |.|     ..||.|...|.      
  Fly    21 DEELSLNTEELQFEELNERSQHQQG---GSP-SFVC----RRCPALFLTREELAAHRPTHRYQGG 77

  Fly   182 EATRSTKMICDADGYYNCPHCSKRFCSQTQLRTHI---TDLCN-RCPYCPRTYMQKSNLKRHLRN 242
            :.|.:::..|||        |.:.|.....|..|:   .|:.| .||.||..::|:||.:.||:|
  Fly    78 QQTPASEHACDA--------CGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKN 134

  Fly   243 -HLSKPAHKCFH--CSKAFMRKDHLKRHLRT-HDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRP 303
             |.....|.|..  |.|.|.::....:|::| |.::..|.|..|||.|...|....|...|    
  Fly   135 VHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASH---- 195

  Fly   304 GSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHML 368
            ||:||..                                       |.||.|.|........|:.
  Fly   196 GSAKSYG---------------------------------------CPICGKLFGRPENRDVHLF 221

  Fly   369 THNRQHHLKK---CTYCSEEFKTEKHLKRH--ERGHMGD 402
            .|:    :.|   |:.|..::.....|.||  ..||..|
  Fly   222 VHS----ICKAYICSVCGADYMRRNQLIRHGLASGHHND 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 23/68 (34%)
C2H2 Zn finger 223..243 CDD:275368 10/20 (50%)
zf-C2H2 249..271 CDD:278523 7/24 (29%)
C2H2 Zn finger 251..271 CDD:275368 6/22 (27%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 5/21 (24%)
C2H2 Zn finger 406..427 CDD:275368
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/23 (26%)
C2H2 Zn finger 87..107 CDD:275368 7/27 (26%)
C2H2 Zn finger 115..136 CDD:275368 10/20 (50%)
C2H2 Zn finger 144..165 CDD:275368 5/20 (25%)
C2H2 Zn finger 175..195 CDD:275368 7/19 (37%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..247 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.