DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and ZNF544

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001374339.1 Gene:ZNF544 / 27300 HGNCID:16759 Length:769 Species:Homo sapiens


Alignment Length:335 Identity:89/335 - (26%)
Similarity:127/335 - (37%) Gaps:77/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ESFT----LHPRKRTCRTEEQADMIPKEATRSTKMIC-----DADGYYNCPHCSKRFCSQTQLRT 214
            :||:    :|.|..|.....:.....|..::|..::.     ..:..|.|..|.|.|..:::|.|
Human   415 KSFSCCKLIHQRTHTGEKPFECTQCGKSFSQSYDLVIHQRTHTGEKPYECDLCGKSFTQRSKLIT 479

  Fly   215 HITDLCNRCPY----CPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDG 275
            |........||    |.:::...|||..|.|.|..:..::|.||.|:|.:...|..|.|||..:.
Human   480 HQRIHTGEKPYQCIECRKSFRWNSNLIVHQRIHTGEKPYECTHCGKSFSQSYELVTHKRTHTGEK 544

  Fly   276 PLSCSQCSAVFIEHVQLEIHRREHK-QRP------GSSKSESTKDPDSDDSDQAQDLKP------ 327
            |..|:||...|.:...|.:|:|.|. ::|      |.|.|:|:|..........:  ||      
Human   545 PFKCTQCGKSFSQKYDLVVHQRTHTGEKPYECNLCGKSFSQSSKLITHQRIHTGE--KPYQCIEC 607

  Fly   328 ----KWTKN------TFNGTCSIPPMLKPKPI-CDICQKKFSSVYALKRHMLTH----------- 370
                :|..|      ...|         .||. |..|.|.||..|.|..|..||           
Human   608 GKSFRWNSNLVIHQRIHTG---------EKPYDCTHCGKSFSQSYQLVAHKRTHTGEKPYECNEC 663

  Fly   371 ----NRQ----HHLK--------KCTYCSEEFKTEKHLKRHERGHMGDL-FRCEFCSLVFVDVNY 418
                ||.    .||:        ||..|::.|....:|..|:|.|.|:. |.|..|...|...:.
Human   664 GKAFNRSTQLIRHLQIHTGEKPYKCNQCNKAFARSSYLVMHQRTHTGEKPFECSQCGKAFSGSSN 728

  Fly   419 LRKHKKRIHS 428
            |..| .||||
Human   729 LLSH-HRIHS 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 23/67 (34%)
C2H2 Zn finger 223..243 CDD:275368 8/23 (35%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 6/20 (30%)
ZNF544NP_001374339.1 KRAB 68..127 CDD:214630
C2H2 Zn finger 410..428 CDD:275368 4/12 (33%)
zf-H2C2_2 424..445 CDD:404364 4/20 (20%)
C2H2 Zn finger 436..456 CDD:275368 2/19 (11%)
COG5048 460..>753 CDD:227381 82/290 (28%)
C2H2 Zn finger 464..484 CDD:275368 7/19 (37%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 8/19 (42%)
C2H2 Zn finger 548..568 CDD:275368 7/19 (37%)
C2H2 Zn finger 576..596 CDD:275368 5/19 (26%)
C2H2 Zn finger 604..624 CDD:275368 2/19 (11%)
C2H2 Zn finger 632..652 CDD:275368 8/19 (42%)
C2H2 Zn finger 660..680 CDD:275368 4/19 (21%)
C2H2 Zn finger 688..708 CDD:275368 6/19 (32%)
C2H2 Zn finger 716..736 CDD:275368 6/20 (30%)
C2H2 Zn finger 744..764 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.