DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and ZFP30

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001307595.1 Gene:ZFP30 / 22835 HGNCID:29555 Length:519 Species:Homo sapiens


Alignment Length:415 Identity:99/415 - (23%)
Similarity:156/415 - (37%) Gaps:98/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KWQSEQSYQ-HFFR---VLNQSGAPENQVHLAACNGDKNQII----------------NQKMQLK 119
            :|:...||| :.:|   :.|.|    |.|.||.|:..|..:|                .::..|.
Human    19 EWECLNSYQRNLYRDVILENYS----NLVSLAGCSISKPDVITLLEQGKEPWMVVRDEKRRWTLD 79

  Fly   120 SDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEA- 183
            .:.:.||:::.:.:    |:.:....|.|:.|              |.::|..|||..  |.|. 
Human    80 LESRYDTKKLFQGK----DIYEMNLSQWKVME--------------RIKSCGLEEQES--PHEVC 124

  Fly   184 ------TRSTKMIC--------------DADGYYNCPHCSKRFCSQTQL----RTHITDLCNRCP 224
                  |.|.||..              :.:..|.|..|.|.|..:.||    |.|..:....|.
Human   125 FRQVTKTTSEKMPTYRKLTSLPLYQKSHNREKPYECGECGKAFRVRQQLTFHQRIHTGEKPYECK 189

  Fly   225 YCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEH 289
            .|.:.:.|.::|.||.|.|.|...::|..|.|.|.....|:.|.|.|..:.|..|.:|...|...
Human   190 ECGKAFRQCAHLSRHQRIHTSDKLYECKKCGKIFTCGSDLRVHQRIHIGEKPYECKECGKAFRVR 254

  Fly   290 VQLEIHRREHK-QRPGSSK---------SESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPML 344
            .||.:|:|.|. ::|...|         :..|:....:.:::..:.|.  ....|  .||....|
Human   255 GQLNLHQRIHTGEKPYECKECGKAFRQYAHLTRHQRLNIAEKCYECKE--CGQAF--LCSTGLRL 315

  Fly   345 K------PKPI-CDICQKKFSSVYALKRHMLTHNRQHHLKK---CTYCSEEFKTEKHLKRHERGH 399
            .      .||. |..|.|.|    .:::.:..|.|.|..:|   |..|.:.|....||..|:|.|
Human   316 HHKLHTGEKPYECKECGKAF----RVRQQLTLHQRIHTGEKPYDCKECGKTFSRGYHLTLHQRIH 376

  Fly   400 MGDL-FRCEFCSLVFVDVNYLRKHK 423
            .|:. :.|:.|...|...:.|..|:
Human   377 TGEKPYECKECQKFFRRYSELISHQ 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 4/10 (40%)
COG5048 220..>284 CDD:227381 20/63 (32%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 4/19 (21%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 5/18 (28%)
ZFP30NP_001307595.1 KRAB 6..67 CDD:214630 14/51 (27%)
COG5048 156..509 CDD:227381 67/254 (26%)
C2H2 Zn finger 160..180 CDD:275368 7/19 (37%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..291 CDD:275368 2/18 (11%)
C2H2 Zn finger 300..320 CDD:275368 5/23 (22%)
C2H2 Zn finger 328..348 CDD:275368 6/23 (26%)
C2H2 Zn finger 356..376 CDD:275368 7/19 (37%)
C2H2 Zn finger 384..404 CDD:275368 5/18 (28%)
C2H2 Zn finger 412..432 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
C2H2 Zn finger 468..488 CDD:275368
C2H2 Zn finger 496..516 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.