DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and ZNF449

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_689908.3 Gene:ZNF449 / 203523 HGNCID:21039 Length:518 Species:Homo sapiens


Alignment Length:399 Identity:92/399 - (23%)
Similarity:143/399 - (35%) Gaps:90/399 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NVRDPVLDEPEMSLSHILARCTERPVKR---GDLLPQFI--CVSCVLAVQNAFRFKWQSEQSYQH 84
            |..||....|::.::..|....|..||.   ...:.|.:  .:...:.::|......|.:....:
Human   182 NFLDPGYPLPKLDMNFSLENREEPWVKELQDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETMY 246

  Fly    85 FFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQKQTLQAKL 149
            .|.|..:..|.:..:    ...|..|:.||......|.|.|..::...|.|        ||....
Human   247 PFIVTLEGNALQGPI----LQKDYVQLENQWETPPEDLQTDLAKLVDQQNP--------TLGETP 299

  Fly   150 QEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQL-- 212
            :..|::.|     |:|:....::       |.|..            :.||.|.|.|..::||  
Human   300 ENSNLEEP-----LNPKPHKKKS-------PGEKP------------HRCPQCGKCFARKSQLTG 340

  Fly   213 --RTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDG 275
              |.|..:..::||.|.:.:::.|:|.||.|.|..:..::|..|.|.|.|:.||..|.|||..:.
Human   341 HQRIHSGEEPHKCPECGKRFLRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEE 405

  Fly   276 PLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSI 340
            ...|.:|...|.....|:.|.:.|...                                      
Human   406 TYKCLECGKSFCHGSSLKRHLKTHTGE-------------------------------------- 432

  Fly   341 PPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL-F 404
                ||.. |..|.|.||.:.||..|..||..:... ||.||.:.|:....|..|.|.|.|:. :
Human   433 ----KPHR-CHNCGKSFSRLTALTLHQRTHTEERPF-KCNYCGKSFRQRPSLVIHLRIHTGEKPY 491

  Fly   405 RCEFCSLVF 413
            :|..||..|
Human   492 KCTHCSKSF 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 11/64 (17%)
COG5048 220..>284 CDD:227381 22/63 (35%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
zf-C2H2 249..271 CDD:278523 9/21 (43%)
C2H2 Zn finger 251..271 CDD:275368 9/19 (47%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 4/8 (50%)
ZNF449NP_689908.3 SCAN 27..134 CDD:322011
SFP1 <235..402 CDD:227516 49/202 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..325 9/64 (14%)
COG5048 <321..483 CDD:227381 54/217 (25%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 353..373 CDD:275368 8/19 (42%)
C2H2 Zn finger 381..401 CDD:275368 9/19 (47%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)
C2H2 Zn finger 437..457 CDD:275368 8/19 (42%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
zf-H2C2_2 477..502 CDD:316026 9/24 (38%)
C2H2 Zn finger 493..513 CDD:275368 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.