DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2678 and klu-2

DIOPT Version :9

Sequence 1:	NP_649750.1	Gene:	CG2678 / 40937	FlyBaseID:	FBgn0014931	Length:	434	Species:	Drosophila melanogaster
Sequence 2:	NP_491843.3	Gene:	klu-2 / 172339	WormBaseID:	WBGene00022592	Length:	386	Species:	Caenorhabditis elegans

Alignment Length:	136	Identity:	35/136 - (25%)
Similarity:	52/136 - (38%)	Gaps:	25/136 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   223 CPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFI 287
            |..|.:.:.:...|.||.|.|..:...||..|.:.|.|.|||:.|.|||..:.|..|..|:
Worm   249 CFICEKDFRRPDILSRHTRRHTGEKPFKCEDCGRFFSRSDHLRTHRRTHTDEKPYHCCVCN---- 309

  Fly   288 EHVQLEIHRREHKQRPGSSKSESTKDPD-----------SDDSD----QAQDLKPKWTKNTFNGT 337
                ....||:...|..|::.::...|.           ..|.|    .||:|:.:  .......
Worm   310 ----YSARRRDVLTRHMSTRHQAIAPPSILGTHRNVRRCLSDGDYHKMAAQELRQR--HQATREE 368

  Fly   338 CSIPPM 343
            ..:|||
Worm   369 VEVPPM 374

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2678	NP_649750.1	zf-AD	8..85	CDD:214871
		COG5048	220..>284	CDD:227381	22/60 (37%)
		C2H2 Zn finger	223..243	CDD:275368	6/19 (32%)
		zf-C2H2	249..271	CDD:278523	10/21 (48%)
		C2H2 Zn finger	251..271	CDD:275368	9/19 (47%)
		C2H2 Zn finger	279..299	CDD:275368	4/19 (21%)
		C2H2 Zn finger	350..370	CDD:275368
		C2H2 Zn finger	379..399	CDD:275368
		C2H2 Zn finger	406..427	CDD:275368
klu-2	NP_491843.3	COG5048	216..>298	CDD:227381	18/48 (38%)
		C2H2 Zn finger	249..269	CDD:275368	6/19 (32%)
		zf-H2C2_2	262..286	CDD:290200	9/23 (39%)
		COG5048	273..>328	CDD:227381	19/62 (31%)
		C2H2 Zn finger	277..297	CDD:275368	9/19 (47%)
		zf-H2C2_2	289..314	CDD:290200	9/32 (28%)
		C2H2 Zn finger	305..324	CDD:275368	5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000