DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and ZNF92

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_689839.1 Gene:ZNF92 / 168374 HGNCID:13168 Length:586 Species:Homo sapiens


Alignment Length:272 Identity:73/272 - (26%)
Similarity:106/272 - (38%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LHPRKRTCRTEEQADMIPKEATRST-----KMICDADGYYNCPHCSKRFCSQTQL----RTHITD 218
            :|..::..:.||    ..|...||:     |:|...:..|.|..|.|.|...:.|    |.|..:
Human   222 IHTGEKPYKCEE----CGKAFNRSSNLTKHKIIHTGEKPYKCEECGKAFNRSSTLTKHKRIHTEE 282

  Fly   219 LCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCS 283
            ...:|..|.:.:.|.|.|.:|.|.|:....:||..|.|||.....||:|...|..:.|..|.:|.
Human   283 KPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCEECG 347

  Fly   284 AVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKP 348
            ..|.:...|..|:..|         ...|....|:..:|.:.....||:....|       ..||
Human   348 KAFNQFSNLTKHKIIH---------TGEKPYKCDECGKAFNQSSTLTKHKRIHT-------GEKP 396

  Fly   349 I-CDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL-FRCEFCSL 411
            . |:.|.|.|.....|..|.:.|..:... ||..|.:.|.......:|:|.||.|. ::||.|..
Human   397 YKCEECGKAFKQSSTLTEHKIIHTGEKPY-KCEKCGKAFSWSSAFTKHKRNHMEDKPYKCEECGK 460

  Fly   412 VFVDVNYLRKHK 423
            .|...:.|.|||
Human   461 AFSVFSTLTKHK 472

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 21/63 (33%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-C2H2 249..271 CDD:278523 9/21 (43%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
C2H2 Zn finger 406..427 CDD:275368 8/18 (44%)
ZNF92NP_689839.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 175..195 CDD:275368