DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and AgaP_AGAP009120

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_319872.4 Gene:AgaP_AGAP009120 / 1280072 VectorBaseID:AGAP009120 Length:321 Species:Anopheles gambiae


Alignment Length:423 Identity:86/423 - (20%)
Similarity:140/423 - (33%) Gaps:125/423 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCRTCMD--ETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQN 70
            :||.|:.  :.|:.||:||      ::...:|...::.||....:...|..|..||..|...::.
Mosquito     6 ICRLCLQGLQDGSCVDLFA------INHLSVSPLAMITRCASIQIYEKDGFPTTICNDCYCKLEM 64

  Fly    71 AFRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKP 135
            |:.|:.:.|.|.|....:||.....:...|      .|.:||.||...:.......::.|..:..
Mosquito    65 AYEFRNRCEASDQKLREMLNIPTGNDKSAH------TKVKIICQKRAARKQPMLGRKRATAKENQ 123

  Fly   136 DDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCP 200
            :    |:|..|.:.|.|                                       ||:..:.|.
Mosquito   124 E----QQQQQQQETQPG---------------------------------------DAENPFQCT 145

  Fly   201 HCSKRFCSQTQLRTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLK 265
            .|.:||              ||.          .||:.|:|.|.::...:|..|||.|....:|.
Mosquito   146 VCQRRF--------------NRA----------GNLRLHMRVHSNERQFQCEICSKLFRTSSNLH 186

  Fly   266 RHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWT 330
            .|.:||..:....|:.|...|....:|..|.:.|....|.                         
Mosquito   187 AHRKTHTDERNFPCTVCERAFRTARELVSHGKTHSDVKGY------------------------- 226

  Fly   331 KNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRH 395
                              :|.:|.|.|.....|..||.|.:......:|..|.::|....:|..|
Mosquito   227 ------------------VCRVCSKGFVKQSYLNTHMNTVHVGLKRYRCQECGKQFSNSSNLIAH 273

  Fly   396 ERGHMGDL-FRCEFCSLVFVDVNYLRKHKKRIH 427
            .|.|.|:. ::|..|...|...:.|.:|.::.|
Mosquito   274 RRVHTGEKPYKCGECDGKFNQSSALTRHIRQQH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 21/78 (27%)
COG5048 220..>284 CDD:227381 18/63 (29%)
C2H2 Zn finger 223..243 CDD:275368 4/19 (21%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 5/20 (25%)
AgaP_AGAP009120XP_319872.4 zf-AD 6..81 CDD:214871 21/80 (26%)
COG5048 <140..304 CDD:227381 48/230 (21%)
C2H2 Zn finger 144..164 CDD:275368 10/43 (23%)
zf-H2C2_2 156..181 CDD:290200 10/24 (42%)
C2H2 Zn finger 172..192 CDD:275368 7/19 (37%)
C2H2 Zn finger 200..220 CDD:275368 5/19 (26%)
C2H2 Zn finger 228..249 CDD:275368 8/20 (40%)
zf-C2H2 255..277 CDD:278523 6/21 (29%)
C2H2 Zn finger 257..277 CDD:275368 6/19 (32%)
zf-H2C2_2 269..294 CDD:290200 8/24 (33%)
C2H2 Zn finger 285..303 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.