DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and AgaP_AGAP005479

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_315481.3 Gene:AgaP_AGAP005479 / 1276170 VectorBaseID:AGAP005479 Length:485 Species:Anopheles gambiae


Alignment Length:529 Identity:117/529 - (22%)
Similarity:173/529 - (32%) Gaps:182/529 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRTC---MDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQ- 69
            ||.|   :..||..:    ::||....|...::.|.       .:.....||:.:|..|...|. 
Mosquito     5 CRLCLGSLSSTGPKI----SIRDAEFQEELKTVFHF-------DIILDTALPEHVCNECRSTVSY 58

  Fly    70 -NAFRFKWQSEQSYQHFFRVLNQSGAPEN----------------------QVHL----AACNGD 107
             :::..:.|:.|     |::|.:  |.||                      :.||    .|.|.:
Mosquito    59 CHSYCLQVQANQ-----FQLLGE--ANENVLKPVENVMVESLVEEDDCTKTEKHLQKEELAVNQE 116

  Fly   108 KNQIINQKMQL---------KSDRQQDTQQMTKTQKPD-------DDLSQKQTLQA-KLQEGNID 155
            ....:..:..|         |:|:|:...:.:...|||       .|.|.|:..|| :|:...| 
Mosquito   117 ATMCLEDREGLSVDEDCVRGKNDKQRRRARQSIKNKPDLQKETENQDTSSKEVSQANQLENDKI- 180

  Fly   156 GPPESFTLHPRKRTCRTEEQADMIPKEAT-RSTKMICDADGYYNCPHCSKRFCSQTQLRTHITDL 219
             ..:.|||.........|....::....| ..||      ||..|  |.|:|..:..|..||...
Mosquito   181 -ITQFFTLECEICAATAESFVQLLDHYRTAHKTK------GYVRC--CGKQFFRRYILVDHIAAH 236

  Fly   220 CN--RCPYCPRTYMQKSNLKRHL---------------RNHLSKP------AHKCFH-------C 254
            ..  ||..|.:||..|..|..|.               :.|:|.|      ||:..|       |
Mosquito   237 RGTIRCEICHKTYKTKRYLALHFAKSHSGETDRPFKCGKCHVSYPKQYLLRAHELMHVQQQCHVC 301

  Fly   255 SKAFMRKDHLKRHL-RTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDD 318
            .|.......|:.|: :.|..||...|..|..||.....:|.|..||.                 .
Mosquito   302 EKVLSNTQSLRVHIAQMHGGDGHHICDTCGKVFRTKPAMERHINEHM-----------------G 349

  Fly   319 SDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRH----------------- 366
            .|..:.|:                       ||.|||.||..|.|::|                 
Mosquito   350 VDVVERLQ-----------------------CDHCQKWFSGKYNLRKHVRFMHLEGGQVFWCELC 391

  Fly   367 ---------MLTHNRQHHLK---KCTYCSEEFKTEKHLKRHERGHMG-DLFRCEFC-SLVF-VDV 416
                     :..|..:.|::   :|.||.:.||...:|:.|...|.. .|:.||.| :..| ...
Mosquito   392 PHESPNSRALANHKLRVHVEERFECEYCGKRFKRRPNLREHIASHTNMPLYSCEICQNRTFNSKA 456

  Fly   417 NYL--RKHK 423
            ||.  ||||
Mosquito   457 NYFTHRKHK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 16/80 (20%)
COG5048 220..>284 CDD:227381 23/94 (24%)
C2H2 Zn finger 223..243 CDD:275368 7/34 (21%)
zf-C2H2 249..271 CDD:278523 6/29 (21%)
C2H2 Zn finger 251..271 CDD:275368 5/27 (19%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 10/45 (22%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 10/22 (45%)
AgaP_AGAP005479XP_315481.3 zf-AD 5..74 CDD:285071 17/84 (20%)
C2H2 Zn finger 219..236 CDD:275368 6/16 (38%)
C2H2 Zn finger 242..263 CDD:275368 7/20 (35%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
C2H2 Zn finger 298..319 CDD:275368 4/20 (20%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
C2H2 Zn finger 358..374 CDD:275368 9/15 (60%)
C2H2 Zn finger 388..409 CDD:275368 1/20 (5%)
C2H2 Zn finger 416..436 CDD:275368 7/19 (37%)
C2H2 Zn finger 444..463 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.