DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2846 and FMN1

DIOPT Version :9

Sequence 1:NP_001287218.1 Gene:CG2846 / 40936 FlyBaseID:FBgn0014930 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_010522.1 Gene:FMN1 / 851822 SGDID:S000002644 Length:218 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:57/151 - (37%)
Similarity:79/151 - (52%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIVRGFGRGSKELGIPTANFPLEVVKSLPESLPTGAYYGWANV---------------------- 54
            :||.||||||.||||||||.|:..:......|..|.|:|:|::                      
Yeast    56 DIVCGFGRGSAELGIPTANVPINQLPKGINDLDLGVYFGFAHIKTVDGQELSVETRRDGRTVVYN 120

  Fly    55 ---------DNGPVHKMVLSIGWNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSF 110
                     |:..|..||||:|.||||.|..|::|.|::|||..|.||..:|..|:|::|||.::
Yeast   121 YGQYLSEANDDLSVLPMVLSVGKNPFYGNDFKTMELHIIHDFKNDFYGARVKFNILGHIRPELNY 185

  Fly   111 DSLESLIAAIRGDIEQAKAFL 131
            .:.|:||..|..||..|:..|
Yeast   186 TTKEALIEDINIDIRTAQTVL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2846NP_001287218.1 Flavokinase 6..131 CDD:279952 56/149 (38%)
FMN1NP_010522.1 RibF 1..207 CDD:223274 57/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341900
Domainoid 1 1.000 97 1.000 Domainoid score I1628
eggNOG 1 0.900 - - E1_COG0196
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115690
Inparanoid 1 1.050 98 1.000 Inparanoid score I1473
Isobase 1 0.950 - 0 Normalized mean entropy S1082
OMA 1 1.010 - - QHG56382
OrthoFinder 1 1.000 - - FOG0005742
OrthoInspector 1 1.000 - - oto100328
orthoMCL 1 0.900 - - OOG6_101300
Panther 1 1.100 - - LDO PTHR22749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1101
SonicParanoid 1 1.000 - - X4136
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.