DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2846 and FMN/FHY

DIOPT Version :9

Sequence 1:NP_001287218.1 Gene:CG2846 / 40936 FlyBaseID:FBgn0014930 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_193878.2 Gene:FMN/FHY / 828232 AraportID:AT4G21470 Length:379 Species:Arabidopsis thaliana


Alignment Length:145 Identity:75/145 - (51%)
Similarity:96/145 - (66%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLFAGGEIVRGFGRGSKELGIPTANFPLEVVKSLPESL---PTGAYYGWANVDNGPVHKMVLSIG 67
            |...||.:::|||||||.|||||||..   .|...:.|   |:|.|:|||.:....|.|||:|||
plant   238 PWHIGGPVIKGFGRGSKVLGIPTANLS---TKDYADELVEHPSGVYFGWAGLAKRGVFKMVMSIG 299

  Fly    68 WNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSFDSLESLIAAIRGDIEQAKAFLD 132
            |||::|||||::|..:||||..|.||:.|::.||||:|||.:|.|||||||.|..|.|.|:..||
plant   300 WNPYFNNKEKTIEPWLLHDFTEDFYGEELRLIIVGYIRPEANFSSLESLIAKIHEDREVAEKALD 364

  Fly   133 EADKAKLKEAPFFTE 147
            ....||.|..|:.|:
plant   365 LPSYAKFKGDPYLTK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2846NP_001287218.1 Flavokinase 6..131 CDD:279952 68/127 (54%)
FMN/FHYNP_193878.2 PLN02940 1..379 CDD:178528 74/143 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1580
eggNOG 1 0.900 - - E1_COG0196
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H115690
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005742
OrthoInspector 1 1.000 - - oto3183
orthoMCL 1 0.900 - - OOG6_101300
Panther 1 1.100 - - LDO PTHR22749
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.