DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2846 and Rfk

DIOPT Version :9

Sequence 1:NP_001287218.1 Gene:CG2846 / 40936 FlyBaseID:FBgn0014930 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001014128.1 Gene:Rfk / 499328 RGDID:1549748 Length:155 Species:Rattus norvegicus


Alignment Length:144 Identity:90/144 - (62%)
Similarity:114/144 - (79%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSQLPLFAGGEIVRGFGRGSKELGIPTANFPLEVVKSLPESLPTGAYYGWANVDNGPVHKMVLSI 66
            :..||.|..|::|||||||||:|||||||||.:||.:||..:.||.|||||:|.:|.|||||:||
  Rat     1 MRSLPFFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADVSTGIYYGWASVGSGEVHKMVVSI 65

  Fly    67 GWNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSFDSLESLIAAIRGDIEQAKAFL 131
            ||||:|.|.:||:|||::|.|..|.||:.|.:.||||||||::||||||||:||:||||:||..|
  Rat    66 GWNPYYKNVKKSMETHIIHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKQL 130

  Fly   132 DEADKAKLKEAPFF 145
            |..:..|||:..||
  Rat   131 DLPEHLKLKDDNFF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2846NP_001287218.1 Flavokinase 6..131 CDD:279952 82/124 (66%)
RfkNP_001014128.1 Flavokinase 5..130 CDD:279952 82/124 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336044
Domainoid 1 1.000 180 1.000 Domainoid score I3421
eggNOG 1 0.900 - - E1_COG0196
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115690
Inparanoid 1 1.050 195 1.000 Inparanoid score I3747
OMA 1 1.010 - - QHG56382
OrthoDB 1 1.010 - - D1534271at2759
OrthoFinder 1 1.000 - - FOG0005742
OrthoInspector 1 1.000 - - oto98760
orthoMCL 1 0.900 - - OOG6_101300
Panther 1 1.100 - - LDO PTHR22749
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4136
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.