DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2846 and fmn1

DIOPT Version :9

Sequence 1:NP_001287218.1 Gene:CG2846 / 40936 FlyBaseID:FBgn0014930 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_588395.1 Gene:fmn1 / 2539192 PomBaseID:SPCC18.16c Length:163 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:58/143 - (40%)
Similarity:86/143 - (60%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SQLPLFAGGEIVRGFGRGSKELGIPTANFPLEVVKSLPESLPTGAYYGWANVDNGPVHKMVLSIG 67
            |..|:...|::|.|||||||||||||||...:.::.|.....:|.|:|:|.|.. .|..||:|:|
pombe    20 SPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQK-RVFPMVMSVG 83

  Fly    68 WNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSFDSLESLIAAIRGDIEQAKAFLD 132
            |||:|.||.:|.|.|::.....|.|.:.:::.::||:|||.::..|:.||..|..||..|...:|
pombe    84 WNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMD 148

  Fly   133 EADKAKLKEAPFF 145
            ....:..|:.|||
pombe   149 RPSYSSYKKDPFF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2846NP_001287218.1 Flavokinase 6..131 CDD:279952 52/124 (42%)
fmn1NP_588395.1 Flavokinase 21..145 CDD:279952 52/124 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1650
eggNOG 1 0.900 - - E1_COG0196
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115690
Inparanoid 1 1.050 118 1.000 Inparanoid score I1522
OMA 1 1.010 - - QHG56382
OrthoFinder 1 1.000 - - FOG0005742
OrthoInspector 1 1.000 - - oto102098
orthoMCL 1 0.900 - - OOG6_101300
Panther 1 1.100 - - LDO PTHR22749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1101
SonicParanoid 1 1.000 - - X4136
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.