DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2846 and R10H10.6

DIOPT Version :9

Sequence 1:NP_001287218.1 Gene:CG2846 / 40936 FlyBaseID:FBgn0014930 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_501922.1 Gene:R10H10.6 / 187789 WormBaseID:WBGene00011224 Length:135 Species:Caenorhabditis elegans


Alignment Length:135 Identity:66/135 - (48%)
Similarity:87/135 - (64%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSQLPLFAGGEIVRGFGRGSKELGIPTANFPLEVVKSLPESLPTGAYYGWANVDNGPVHKMVLSI 66
            ::.||....||:|||||||.||||.||||....||..|||.||.|.|:|.|.:| |..:||.:||
 Worm     1 MNLLPYQFVGEVVRGFGRGGKELGCPTANMDGTVVNGLPEGLPVGVYFGTAKLD-GKSYKMAMSI 64

  Fly    67 GWNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSFDSLESLIAAI--------RGD 123
            ||||.|.|::|:||.|::.....|.||:||...|:|::|..:||:||:.|.:||        ||.
 Worm    65 GWNPQYQNEKKTVELHLIDYSGSDFYGKTLSAVIIGFIREMKSFESLDELKSAIAMDIKVARRGS 129

  Fly   124 IEQAK 128
            :||.|
 Worm   130 VEQGK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2846NP_001287218.1 Flavokinase 6..131 CDD:279952 65/131 (50%)
R10H10.6NP_501922.1 Flavokinase 5..127 CDD:376594 60/122 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156845
Domainoid 1 1.000 128 1.000 Domainoid score I3314
eggNOG 1 0.900 - - E1_COG0196
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115690
Inparanoid 1 1.050 129 1.000 Inparanoid score I3227
Isobase 1 0.950 - 0 Normalized mean entropy S1082
OMA 1 1.010 - - QHG56382
OrthoDB 1 1.010 - - D1534271at2759
OrthoFinder 1 1.000 - - FOG0005742
OrthoInspector 1 1.000 - - oto18871
orthoMCL 1 0.900 - - OOG6_101300
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1101
SonicParanoid 1 1.000 - - X4136
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.650

Return to query results.
Submit another query.