DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf7 and taf7

DIOPT Version :9

Sequence 1:NP_649748.1 Gene:Taf7 / 40934 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001006764.1 Gene:taf7 / 448449 XenbaseID:XB-GENE-5844280 Length:349 Species:Xenopus tropicalis


Alignment Length:448 Identity:136/448 - (30%)
Similarity:201/448 - (44%) Gaps:117/448 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KQAEHKARDDGV-ELESQFIMRVPKELADTVHEAINAGTI--KDRLTIQLDPDLRYGEVRIDDQI 103
            ||...:::||.. |||||||:|:|:|.|.||...:.:|::  ||||:::|.||.|:|.||:|...
 Frog     5 KQKTSRSKDDAPHELESQFILRLPQEYASTVRRMVQSGSVNTKDRLSVELHPDGRHGIVRVDRVP 69

  Fly   104 LYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEE------REDETEKESPNKNKKKDPNKV 162
            |..||||:|.|||..||||.|:.||:|||||:|:|..:      .|:.|....|..:||||.:: 
 Frog    70 LAAKLVDIPCVVECLKTIDKKTCYKTADICQMLVCTLDGDLYPPLEEPTGTSDPKASKKKDRDR- 133

  Fly   163 DKKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEIINE-EDKP 226
            :||:::.||||||.|||||||||||.|||.:|:|::|||||.||..|.|||.|.:|:|.| |.|.
 Frog   134 EKKFIWNHGITPPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDESKE 198

  Fly   227 MDELEQSDIKPYNDADDDLQDESTMHASEKTIMEMSSQRHLQVESDDDEASNFPSHRAPNMGVAV 291
            .:.|...|:.|........:..|.:...|                                   :
 Frog   199 AENLTGLDVSPGMSGIKQGRGSSAVEREE-----------------------------------L 228

  Fly   292 HDIFGEEVSSTDDEDEPDRGNNTMQRRVMEESSRLSADDSRMSDFFGASGSNTGAGVVKMEQNVF 356
            ..||.:..||:|.|:|...........:||......|         |..|...|...:.:|    
 Frog   229 RQIFNDISSSSDGEEEEGERQEEEDLNIMETEEEQRA---------GQDGQKGGTNQIVLE---- 280

  Fly   357 SKSMFGHEASSPKLSAAGSSSNLAAPSGFYDSQMLAKREEFENMEFIDEPQPQYTQQQVQQKINQ 421
                                                                      :|:::..
 Frog   281 ----------------------------------------------------------MQKQLEN 287

  Fly   422 LTRQIRELKAQQVQKSTEIASIQNATLKQRMQETLDNLYTQVIERELELKDFENMLES 479
            |.:::||.:.::.::...|..::|..||.|:|..||....|....:.:|...:..||:
 Frog   288 LQKKLRETQERRKRQEELIMKVENVALKTRLQAVLDEFRQQEEREKQQLTSLQEQLET 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 88/165 (53%)
taf7NP_001006764.1 TAFII55_N 19..184 CDD:368041 88/165 (53%)
Nup88 <274..346 CDD:370849 17/134 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 171 1.000 Domainoid score I3695
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348389at2759
OrthoFinder 1 1.000 - - FOG0001971
OrthoInspector 1 1.000 - - oto104139
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1474
SonicParanoid 1 1.000 - - X1289
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.