DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf7 and taf-7.2

DIOPT Version :9

Sequence 1:NP_649748.1 Gene:Taf7 / 40934 FlyBaseID:FBgn0024909 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001379275.1 Gene:taf-7.2 / 176686 WormBaseID:WBGene00006389 Length:236 Species:Caenorhabditis elegans


Alignment Length:208 Identity:81/208 - (38%)
Similarity:123/208 - (59%) Gaps:15/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DDGVELESQFIMRVPKELADTVHEAINAGTIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTV 114
            ||..:.||..::|||::....:.:.|.:....:..::.|:.|.|...|||.:|:|..|::||||:
 Worm    30 DDPPDFESHIVLRVPEDCVGRIEKIIQSDGKHEEFSLNLNSDARNSTVRIGNQLLNGKILDLPTI 94

  Fly   115 VESYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHGITPPCKNV 179
            .|.:||:||||.||.||:.|||:|..:..:.....|.:..:|....|. |::.:|||:|||.|:.
 Worm    95 TEIHKTLDNKSLYKVADVSQILVCTHDSINSIASSSEDAAQKAAAAKA-KQWQYPHGLTPPMKSA 158

  Fly   180 RKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEII--NEEDK------------PMDEL 230
            ||:|||||.|||.::|||:|||:|.|||.|.||..|.:||:  |:|..            |....
 Worm   159 RKKRFRKTKKKKFMDAPEVEKELKRLLRADLEADSVKWEIVEGNKEGATDEVRTQRHVTYPSSSE 223

  Fly   231 EQSDIKPYNDADD 243
            ::||:...:|.||
 Worm   224 DESDVGDDDDKDD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf7NP_649748.1 TAFII55_N 55..213 CDD:282507 67/157 (43%)
taf-7.2NP_001379275.1 TAF7 36..199 CDD:173966 70/163 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156347
Domainoid 1 1.000 138 1.000 Domainoid score I2996
eggNOG 1 0.900 - - E1_COG5414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348389at2759
OrthoFinder 1 1.000 - - FOG0001971
OrthoInspector 1 1.000 - - otm14179
orthoMCL 1 0.900 - - OOG6_102177
Panther 1 1.100 - - LDO PTHR12228
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1474
SonicParanoid 1 1.000 - - X1289
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.