DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and rpsI

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_417697.1 Gene:rpsI / 949000 ECOCYCID:EG10908 Length:130 Species:Escherichia coli


Alignment Length:130 Identity:55/130 - (42%)
Similarity:78/130 - (60%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QYITTYECLRKTARADVTVRLPGTGKISINGKDI-SYFEDENCREQLLFPLQFSELLGKVDVEAN 330
            ||..|..  ||::.|.|.:: ||.|||.||.:.: .||..|..|..:..||:..:::.|:|:...
E. coli     5 QYYGTGR--RKSSAARVFIK-PGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYIT 66

  Fly   331 VEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWKKR 395
            |:|||.||||||||.||..:|..: |:.:...:|.||.:|||.|:.||||.|...|||:..:.||
E. coli    67 VKGGGISGQAGAIRHGITRALMEY-DESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR 130

  Fly   396  395
            E. coli   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 50/119 (42%)
rpsINP_417697.1 rpsI 1..130 CDD:178888 53/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I420
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto111869
orthoMCL 1 0.900 - - OOG6_101155
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.