DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and MRPS9

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_009704.1 Gene:MRPS9 / 852443 SGDID:S000000350 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:90/279 - (32%)
Similarity:134/279 - (48%) Gaps:54/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DETGR---PFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNK-PDENQK---------- 190
            ||..|   |..:.||:..||     |:  :..|:|    ||:||:..| |.:|..          
Yeast    31 DELPRRIVPKLATFYSANPN-----HE--DRINRL----ERLLRKYIKLPSQNNNEAQQTKAPWI 84

  Fly   191 ------LEIAGFQLLPKDQLELL-LVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLM 248
                  |...|.:|.|....:|| ::..:.:|: ...||.......|.| ||..:.:...:|   
Yeast    85 SFDEYALIGGGTKLKPTQYTQLLYMLNKLHNID-PQLTNDEITSELSQY-YKKSSMLSNNIK--- 144

  Fly   249 DQSKQLEVPKPRIDEEGRQYITTYECLRKTARADVTVRLPGTGKISINGKDIS-YFEDENCREQL 312
                     ...:||.||.....   .||::.|.|.| :.|||:|.:||:.:: ||.....||.:
Yeast   145 ---------IKTLDEFGRSIAVG---KRKSSTAKVFV-VRGTGEILVNGRQLNDYFLKMKDRESI 196

  Fly   313 LFPLQFSELLGKVDVEANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIES-MRLAGLLTRDYRRR 376
            ::|||..|.:||.::.|...||||:|||.:|...||.:|..|  ..:::| :..||:||||||..
Yeast   197 MYPLQVIESVGKYNIFATTSGGGPTGQAESIMHAIAKALVVF--NPLLKSRLHKAGVLTRDYRHV 259

  Fly   377 ERKKFGQEGARRKYTWKKR 395
            ||||.|::.||:..||.||
Yeast   260 ERKKPGKKKARKMPTWVKR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 52/120 (43%)
MRPS9NP_009704.1 Ribosomal_S9 158..278 CDD:395304 52/125 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344418
Domainoid 1 1.000 89 1.000 Domainoid score I1797
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto99881
orthoMCL 1 0.900 - - OOG6_101155
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1259
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.