DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and RPS16B

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_010200.1 Gene:RPS16B / 851476 SGDID:S000002241 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:44/127 - (34%)
Similarity:62/127 - (48%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RKTARADVTVRLPGTGKISINGKDISYFEDENCREQLLFPLQFSEL--LGKVDVEANVEGGGPSG 338
            :|:|.|...|: .|.|.|.:||..|:..|.|..|.::..||....|  ...:|:...|.|||...
Yeast    13 KKSATAVAHVK-AGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVTGGGHVS 76

  Fly   339 QAGAIRWGIAMSL----RSFVDQEMIESMRLA------GLLTRDYRRRERKKFGQEGARRKY 390
            |..|||..||..|    :.:||::....::.|      .||..|.||.|.||||.:|||.::
Yeast    77 QVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 44/127 (35%)
RPS16BNP_010200.1 PLN00210 3..143 CDD:177799 44/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.