DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and RPS9

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_177635.1 Gene:RPS9 / 843836 AraportID:AT1G74970 Length:208 Species:Arabidopsis thaliana


Alignment Length:122 Identity:45/122 - (36%)
Similarity:61/122 - (50%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RKTARADVTVRLPGTGKISINGKDISYFEDEN--CREQLLFPLQFSELLGKVDVEANVEGGGPSG 338
            ||.|.|.|.:: .||||:.||.:|...:...|  ..:.:..||.........|:.....|||.||
plant    89 RKCAIARVVLQ-EGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSG 152

  Fly   339 QAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWKKR 395
            ||.||..|:|.:|.. |..:....::..||||||.|..||||.|.:.||:...:.||
plant   153 QAQAITLGVARALLK-VSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 43/120 (36%)
RPS9NP_177635.1 rps9 81..208 CDD:214357 43/120 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1430790at2759
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - otm2897
orthoMCL 1 0.900 - - OOG6_101155
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3496
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.