DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and Mrps9

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_076003.3 Gene:Mrps9 / 69527 MGIID:1916777 Length:390 Species:Mus musculus


Alignment Length:327 Identity:153/327 - (46%)
Similarity:215/327 - (65%) Gaps:8/327 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DEFMKTQHLEFQIGKRHLANMMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPAR 134
            ::|:|.|..||.|||||||||||.|.|||.:||||.||:|||||||::::|||.||.||.:||.:
Mouse    71 EDFIKKQIEEFNIGKRHLANMMGEDPETFAEEDIDRAIAYLFPSGLFEKRARPMMKHPEHIFPKQ 135

  Fly   135 KAAEFDETGRPFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLL 199
            :|.::.|.|||||.:|||||.:::.|:||:.   .|:..||:   .||......:..::.|.:.|
Mouse   136 RATQWGEDGRPFHFLFYTGKQSYYSLMHDVY---GKVMQLEK---HRGPLSASAESRDLIGSRWL 194

  Fly   200 PKDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPKPRIDEE 264
            .|::||.:|||.::|.:|:.|...:::|:..|.....:.|::|:.:.:..|||:..:...:.||:
Mouse   195 IKEELEEMLVEKLSDEDYAQFIRLLEKLLTLPCGPAEEEFVQRFRRSVTIQSKKQLIEPVQYDEQ 259

  Fly   265 GRQYITTYECLRKTARADVTVRLPGTGKISINGKD-ISYFEDENCREQLLFPLQFSELLGKVDVE 328
            |..: :|.|..||:|.|...|...|:|||.:||.| :.||.....||||:||..|.:.|.:.||.
Mouse   260 GMAF-STSEGRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFPFHFLDRLERHDVT 323

  Fly   329 ANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWK 393
            ..|.|||.|.||||||..:|.:|.|||.::.:|.||.|||||.|.|.|||||.||||||||:|||
Mouse   324 CTVSGGGRSAQAGAIRLAMARALCSFVTEDEVEWMRQAGLLTPDPRIRERKKPGQEGARRKFTWK 388

  Fly   394 KR 395
            ||
Mouse   389 KR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 66/119 (55%)
Mrps9NP_076003.3 Ribosomal_S9 268..390 CDD:278792 66/121 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..390 17/21 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839754
Domainoid 1 1.000 173 1.000 Domainoid score I3688
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32565
Inparanoid 1 1.050 284 1.000 Inparanoid score I2844
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46075
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto94172
orthoMCL 1 0.900 - - OOG6_101155
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1259
SonicParanoid 1 1.000 - - X3496
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.