DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and MRPS9

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_872578.1 Gene:MRPS9 / 64965 HGNCID:14501 Length:396 Species:Homo sapiens


Alignment Length:333 Identity:155/333 - (46%)
Similarity:219/333 - (65%) Gaps:2/333 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KRATEHDEFMKTQHLEFQIGKRHLANMMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPE 128
            ||.|..::|:|.|..||.|||||||||||.|.|||||||||.||:|||||||::::|||.||.||
Human    65 KRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPE 129

  Fly   129 VVFPARKAAEFDETGRPFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEI 193
            .:||.::|.::.|.|||||.:|||||.:::.|:||:......|...:..:..:...|::....::
Human   130 QIFPRQRAIQWGEDGRPFHYLFYTGKQSYYSLMHDVYGMLLNLEKHQSHLQAKSLLPEKTVTRDV 194

  Fly   194 AGFQLLPKDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPK 258
            .|.:.|.|::||.:|||.::|::|..|...:::|:.|......:.|::|:.:.:..:||:..:..
Human   195 IGSRWLIKEELEEMLVEKLSDLDYMQFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQLIEP 259

  Fly   259 PRIDEEGRQYITTYECLRKTARADVTVRLPGTGKISINGKDIS-YFEDENCREQLLFPLQFSELL 322
            .:.||:|..: :..|..||||:|:..|...|:|:|.:||.|.. ||.....||||:||..|.:.|
Human   260 VQYDEQGMAF-SKSEGKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRL 323

  Fly   323 GKVDVEANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGAR 387
            ||.||...|.|||.|.||||||..:|.:|.|||.::.:|.||.|||||.|.|.|||||.||||||
Human   324 GKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGAR 388

  Fly   388 RKYTWKKR 395
            ||:|||||
Human   389 RKFTWKKR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 68/119 (57%)
MRPS9NP_872578.1 Ribosomal_S9 274..396 CDD:395304 68/121 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..396 17/21 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149702
Domainoid 1 1.000 180 1.000 Domainoid score I3528
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32565
Inparanoid 1 1.050 297 1.000 Inparanoid score I2742
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46075
OrthoDB 1 1.010 - - D1430790at2759
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto90580
orthoMCL 1 0.900 - - OOG6_101155
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1259
SonicParanoid 1 1.000 - - X3496
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.