DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and AgaP_AGAP010270

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_319461.1 Gene:AgaP_AGAP010270 / 3292153 VectorBaseID:AGAP010270 Length:84 Species:Anopheles gambiae


Alignment Length:84 Identity:64/84 - (76%)
Similarity:74/84 - (88%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 LLFPLQFSELLGKVDVEANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRR 376
            :||||.|:::.||:||.|||.|||||.||||:||||||:||||||::.|..||:|||||||||||
Mosquito     1 VLFPLLFTKMYGKIDVTANVSGGGPSSQAGAVRWGIAMALRSFVDEDQIARMRVAGLLTRDYRRR 65

  Fly   377 ERKKFGQEGARRKYTWKKR 395
            ||||.||.|||||||||||
Mosquito    66 ERKKPGQAGARRKYTWKKR 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 62/82 (76%)
AgaP_AGAP010270XP_319461.1 Ribosomal_S9 <1..84 CDD:278792 62/82 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 264 1.000 Domainoid score I4506
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 437 1.000 Inparanoid score I3592
OMA 1 1.010 - - QHG46075
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - otm50757
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3496
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.