DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and Mrps9

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001094019.1 Gene:Mrps9 / 301371 RGDID:1306558 Length:390 Species:Rattus norvegicus


Alignment Length:327 Identity:153/327 - (46%)
Similarity:218/327 - (66%) Gaps:8/327 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DEFMKTQHLEFQIGKRHLANMMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPAR 134
            ::|::.|..||.:||||||||||.|.||||:||||.||:|||||||::::|||.||.||.:||.:
  Rat    71 EDFIRKQIEEFNLGKRHLANMMGEDPETFTEEDIDRAIAYLFPSGLFEKRARPMMKHPEQIFPKQ 135

  Fly   135 KAAEFDETGRPFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLL 199
            :|.::.|.|||||.:|||||.:::.|:||:.   .|:..||:   .||...:..:..::.|.:.|
  Rat   136 RAIQWGEDGRPFHFLFYTGKQSYYSLMHDVY---GKVLQLEK---HRGPLSENTESRDLIGSRWL 194

  Fly   200 PKDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPKPRIDEE 264
            .|::||.:|||.::|.:|:.|...:::|:..|.....:.|::|:.:.:..|||:..:...:.||:
  Rat   195 IKEELEEMLVEKLSDQDYTQFIRLLEKLLTLPCGPAEEDFVQRFRRSVTVQSKKQLIEPVQYDEQ 259

  Fly   265 GRQYITTYECLRKTARADVTVRLPGTGKISINGKD-ISYFEDENCREQLLFPLQFSELLGKVDVE 328
            |..: :|.|..||:|.|.|.|...|:|||.:||.| :.||.....||||:||..|.:.|.|.||.
  Rat   260 GMAF-STSEGRRKSATARVVVYQHGSGKIHVNGVDYLLYFPILQDREQLMFPFHFLDRLEKHDVT 323

  Fly   329 ANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWK 393
            ..|.|||.|.||||||..:|.:|.||:.::.:|.||.|||||.|.|.|||||.||||||||:|||
  Rat   324 CTVSGGGRSAQAGAIRLAMAKALCSFITEDEVEWMRQAGLLTPDPRIRERKKPGQEGARRKFTWK 388

  Fly   394 KR 395
            ||
  Rat   389 KR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 67/119 (56%)
Mrps9NP_001094019.1 Ribosomal_S9 268..390 CDD:395304 67/121 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343594
Domainoid 1 1.000 175 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32565
Inparanoid 1 1.050 287 1.000 Inparanoid score I2755
OMA 1 1.010 - - QHG46075
OrthoDB 1 1.010 - - D1430790at2759
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto97694
orthoMCL 1 0.900 - - OOG6_101155
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3496
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.