DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and SPAC29A4.03c

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_594879.2 Gene:SPAC29A4.03c / 2542620 PomBaseID:SPAC29A4.03c Length:271 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:76/260 - (29%)
Similarity:128/260 - (49%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PFHSMFYTGKPNFFQL---LHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLLPKDQLEL 206
            |.:..::|....|.::   |.:|::...|:...||.:.::....::.|| |.:.    ||     
pombe    36 PDNPSYFTQNARFNEIYLHLENILKFAPKIIAAEEDVPKKWKTLEQYQK-EFSD----PK----- 90

  Fly   207 LLVESIADIEYSNFTNSMDRLIASPYAYKSKAF---IERYMKPLMDQSKQLEVPKPRIDEEGRQY 268
                 ...:.|...|..::.|......|:::|.   :|::::|  |...:..:....:||.|.. 
pombe    91 -----TTKVGYRKITRLLNELNEIVPEYRTEAVQKALEKFIRP--DIVVKTTLKSQMLDENGMS- 147

  Fly   269 ITTYECLRKTARADVTVRLPGTGKISINGKDIS-YFEDENCREQLLFPLQFSELLGKVDVEANVE 332
            ||..:  ||:::|.|.: ||||||..:||.... ||:....|:..::||.....|...:|.|.|.
pombe   148 ITKGK--RKSSKATVKM-LPGTGKFYVNGSPFDVYFQRMVHRKHAVYPLAACNRLTNYNVWATVH 209

  Fly   333 GGGPSGQAGAIRWGIAMSLRSFVDQE--MIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWKKR 395
            ||||:||:||:...|:.||   :.||  :.:.::....:..|.|:.||||.||..||:||||.||
pombe   210 GGGPTGQSGAVHAAISKSL---ILQEPSLKQVIKDTHCVLNDKRKVERKKTGQPKARKKYTWVKR 271

  Fly   396  395
            pombe   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 48/121 (40%)
SPAC29A4.03cNP_594879.2 RpsI 145..271 CDD:223181 51/132 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I2362
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto101572
orthoMCL 1 0.900 - - OOG6_101155
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1259
SonicParanoid 1 1.000 - - X3496
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.