DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and rps-16

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001379167.1 Gene:rps-16 / 179998 WormBaseID:WBGene00004485 Length:144 Species:Caenorhabditis elegans


Alignment Length:130 Identity:46/130 - (35%)
Similarity:64/130 - (49%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RKTARADVTVRLPGTGKISINGKDISYFEDENCREQLLFPLQFSELLGK-----VDVEANVEGGG 335
            :|||.| |.....|.|.|.:||:.:.:.|.:..|.:|..||.   |:||     ||:...|.|||
 Worm    14 KKTATA-VAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLL---LVGKERFQDVDIRIRVSGGG 74

  Fly   336 PSGQAGAIRWGIAMSL----RSFVDQEMIESMRL------AGLLTRDYRRRERKKFGQEGARRKY 390
            ...|..|:|..:|.:|    ..:||::....::.      ..||..|.||||.||||..|||.:|
 Worm    75 HVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRRRESKKFGGPGARARY 139

  Fly   391  390
             Worm   140  139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 46/130 (35%)
rps-16NP_001379167.1 PTZ00086 1..144 CDD:185437 46/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.