DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and AgaP_AGAP010268

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_319459.4 Gene:AgaP_AGAP010268 / 1279692 VectorBaseID:AGAP010268 Length:311 Species:Anopheles gambiae


Alignment Length:283 Identity:151/283 - (53%)
Similarity:201/283 - (71%) Gaps:7/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YMAAAPFATDVTVQAAPAAVQKQRVSKAMRAYLKRATEHDEFMKTQHLEFQIGKRHLANMMGADA 95
            ::::...|.||      .:|||.::||||:|||:||.|::..|:|..||:::||||||||||||.
Mosquito    27 HLSSVNKAEDV------ESVQKAKISKAMKAYLERAKEYESCMETARLEYKLGKRHLANMMGADV 85

  Fly    96 ETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPARKAAEFDETGRPFHSMFYTGKPNFFQL 160
            |||||||||:|:.|||||||||..|||.||.||...|.:|.|||||||||||.:||||:||||||
Mosquito    86 ETFTQEDIDQAVQYLFPSGLYDPAARPTMKPPEEFIPRKKGAEFDETGRPFHPLFYTGRPNFFQL 150

  Fly   161 LHDIVEETNKLADLEERMLRRGNKPDE-NQKLEIAGFQLLPKDQLELLLVESIADIEYSNFTNSM 224
            |.|:||..|||..||:....:|...|. .:|::..|.:.|||:.||..:||:|:||||.||.::|
Mosquito   151 LFDVVENINKLNALEDSTRMKGKSLDSVGKKIDTTGSEWLPKELLEKKIVETISDIEYDNFISAM 215

  Fly   225 DRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPKPRIDEEGRQYITTYECLRKTARADVTVRLPG 289
            :||.|.|.:.:.|.|:..|.|||:.:.....:|.|:.||:|||.:|.|||||||||.|||::.||
Mosquito   216 NRLEAHPLSDRVKDFVFEYRKPLISKLDNDTIPVPQHDEDGRQCVTIYECLRKTARGDVTLKFPG 280

  Fly   290 TGKISINGKDISYFEDENCREQL 312
            ||||.:||:|:....:...|||:
Mosquito   281 TGKIEVNGQDLRSVGNTQQREQV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 20/37 (54%)
AgaP_AGAP010268XP_319459.4 Ribosomal_S9 267..>303 CDD:294239 19/35 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 264 1.000 Domainoid score I4506
eggNOG 1 0.900 - - E1_COG0103
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32565
Inparanoid 1 1.050 437 1.000 Inparanoid score I3592
OMA 1 1.010 - - QHG46075
OrthoDB 1 1.010 - - D1430790at2759
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - otm50757
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3496
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.