DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and AgaP_AGAP011424

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_317881.2 Gene:AgaP_AGAP011424 / 1278269 VectorBaseID:AGAP011424 Length:148 Species:Anopheles gambiae


Alignment Length:130 Identity:50/130 - (38%)
Similarity:65/130 - (50%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RKTARADVTVRLPGTGKISINGKDISYFEDENCREQLLFPLQFSELLGK-----VDVEANVEGGG 335
            :|||.| |.....|.|.:.|||:.:...|.:..|.:|..||.   ||||     ||:...|.|||
Mosquito    18 KKTATA-VAHCKRGKGLLRINGRPLDQIEPKILRYKLQEPLL---LLGKEKFAGVDIRIRVSGGG 78

  Fly   336 PSGQAGAIRWGIAMSLRSFVDQEMIESMR--LAGLLTR--------DYRRRERKKFGQEGARRKY 390
            ...|..|||..|:.:|.||..:.:.|:.|  |..:||:        |.||.|.||||..|||.:|
Mosquito    79 HVAQIYAIRQAISKALVSFYQKYVDEASRKELKDILTQYDRTLLVADPRRCEPKKFGGPGARARY 143

  Fly   391  390
            Mosquito   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 50/130 (38%)
AgaP_AGAP011424XP_317881.2 PTZ00086 4..148 CDD:185437 50/130 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.