DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and ccdc60

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_012824143.2 Gene:ccdc60 / 101731791 -ID:- Length:657 Species:Xenopus tropicalis


Alignment Length:173 Identity:37/173 - (21%)
Similarity:65/173 - (37%) Gaps:35/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CYMAAAPFA--TDVTV----QAAPAAVQKQRVSKAMRAY---LKRATEHDEFMKTQHLEFQIGKR 85
            |.:..||.|  .|..|    |:....:|:.:.|.|...|   |....:...|.|.:.:.|::   
 Frog   433 CTLLRAPSAQTEDFPVREDQQSNRILLQRPKSSPATTLYPSNLVTKKKQAVFSKMRDMFFEV--- 494

  Fly    86 HLANMMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKS-PEVVFPARKAAEFDETGRPFHSM 149
                  .|||:|...:.::..........:...::..:|:: .:.:...|.|..:.:..|.    
 Frog   495 ------AADADTIFHDKVEARERRCQEVNIQKYRSLDSMQNFHQDLEKMRNAYHYVKEDRD---- 549

  Fly   150 FYTGKPNFFQLL-----------HDIVEETNKLADLEERMLRR 181
             |..|.|:|.:|           |.|....|||..|||::..|
 Frog   550 -YKDKNNWFVVLMSRIPQEMMKNHKIHNIVNKLEKLEEKLFVR 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792
ccdc60XP_012824143.2 DUF4698 156..641 CDD:406253 37/173 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165168900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.