DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS9 and mrps9

DIOPT Version :9

Sequence 1:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002941200.2 Gene:mrps9 / 100497348 XenbaseID:XB-GENE-995324 Length:384 Species:Xenopus tropicalis


Alignment Length:372 Identity:168/372 - (45%)
Similarity:235/372 - (63%) Gaps:20/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VQAAPAAVQKQRVS-----KAMRAYLKRATEH-------------DEFMKTQHLEFQIGKRHLAN 89
            ::||....:|..::     :|.|.....||.|             :.|:|.|..|:.||||||||
 Frog    14 LRAAGTCSRKSTLTAGACGEASRLIHNSATVHRKNVAAPGCEKYTEAFIKKQIEEYNIGKRHLAN 78

  Fly    90 MMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPARKAAEFDETGRPFHSMFYTGK 154
            |||.|.|||||||||.||:|||||||:|:||||.||.||.:||.::|.::.|.|||||.:|||||
 Frog    79 MMGEDPETFTQEDIDRAIAYLFPSGLFDKKARPIMKHPEDIFPKQRAIQWGEDGRPFHFLFYTGK 143

  Fly   155 PNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLLPKDQLELLLVESIADIEYSN 219
            |:::.|:|::..:...:...||:|..:|...:..:::::.|.:.|.|::||.:|||.::|.:|.:
 Frog   144 PSYYSLMHELYGKLLSIQKYEEQMRSKGLYTENTKQMDLIGSRWLIKEELEEMLVEKLSDQDYLH 208

  Fly   220 FTNSMDRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPKPRIDEEGRQYITTYECLRKTARADVT 284
            |...::||:..||....:.::.::.|.|..|||:..|...:.||.||.: :|.|..||||.|.|.
 Frog   209 FLQMLERLLILPYCSIEEEYVLKFRKNLEVQSKKQVVNPLQYDEHGRAF-STGEGKRKTALATVV 272

  Fly   285 VRLPGTGKISINGKD-ISYFEDENCREQLLFPLQFSELLGKVDVEANVEGGGPSGQAGAIRWGIA 348
            :...|.|.:.:||.: |.||.....||||:||.||.:.|||.|:|..|.|||.|.||||||...:
 Frog   273 LHESGNGTMVVNGVNYIEYFTVLQDREQLMFPFQFLDRLGKHDLECTVAGGGKSSQAGAIRLATS 337

  Fly   349 MSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGARRKYTWKKR 395
            .:|.|||.:..||:||.|||||.|.|.:||||.||||||||:|||||
 Frog   338 RALLSFVSENEIEAMRQAGLLTTDPRVKERKKPGQEGARRKFTWKKR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 67/119 (56%)
mrps9XP_002941200.2 Ribosomal_S9 262..384 CDD:395304 67/121 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 189 1.000 Domainoid score I3233
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32565
Inparanoid 1 1.050 304 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1430790at2759
OrthoFinder 1 1.000 - - FOG0002710
OrthoInspector 1 1.000 - - oto104380
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1259
SonicParanoid 1 1.000 - - X3496
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.