DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wtrw and ANKRD44

DIOPT Version :10

Sequence 1:NP_731193.1 Gene:wtrw / 40931 FlyBaseID:FBgn0260005 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001354424.1 Gene:ANKRD44 / 91526 HGNCID:25259 Length:1074 Species:Homo sapiens


Alignment Length:431 Identity:126/431 - (29%)
Similarity:189/431 - (43%) Gaps:100/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 IESLLEAGADLHFCDQNGISALHLSAFSGCLATLGLLVAKGLNVNLQSKCY-TPLHCAAFGNAAE 229
            |..|:....|::..|....:.||::||.|....:.||:..|..||.:...: ||||.|....:.|
Human    24 IRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEE 88

  Fly   230 AAKLLINNGADIS---KDTSKPNCEESLLHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLA 291
            |.::||.:.||::   |:...|      ||.|..:.|::|.::.|...:.||.....|..|:|.|
Human    89 AVQVLIKHSADVNARDKNWQTP------LHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHA 147

  Fly   292 ADLGNIQCLEALLNAPNADANVRICIREKESTALHLAADEGNVECVDLLLAKGADAKLKNHRGFT 356
            |..|:::.:..|| |..|:.|   ...:|:..|||.||..|:::.|.||:..||:...|:.:|:|
Human   148 ALNGHVEMVNLLL-AKGANIN---AFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYT 208

  Fly   357 PLHLAARTSSLDCVESLLRNG------NADANAEDFDHRTPLHAAVGKSENAYDIMETLIQWGAN 415
            |||.||....::.|:.||..|      |...|       |.||.|....::|  ::..||.:|||
Human   209 PLHAAASNGQINVVKHLLNLGVEIDEINVYGN-------TALHIACYNGQDA--VVNELIDYGAN 264

  Fly   416 VNHKDIYGFTALHLAALD--GLVQCVEMLIFHGADVTTKSKKGTSALNV------ITR------- 465
            ||..:..|||.||.||..  |.: |:|:|:.:||||..:||.|.|.|::      .||       
Human   265 VNQPNNNGFTPLHFAAASTHGAL-CLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQN 328

  Fly   466 -----------KTPASVA-----------MIRQKLDAAITLHHSQDPVNREVELELDFRQLLQHC 508
                       .||..||           :|....|.|....||..|::                
Human   329 GGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLH---------------- 377

  Fly   509 HPREISYLNTFVD-------EGQKEIL------EHPLCSSF 536
                ::.||...|       .|||..:      ||.|.:.|
Human   378 ----LAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtrwNP_731193.1 ANK repeat 182..213 CDD:293786 10/30 (33%)
ANKYR 196..482 CDD:440430 103/332 (31%)
ANK repeat 215..242 CDD:293786 11/27 (41%)
ANK repeat 250..281 CDD:293786 8/30 (27%)
ANK repeat 283..317 CDD:293786 11/33 (33%)
ANK repeat 323..351 CDD:293786 11/27 (41%)
ANK repeat 353..385 CDD:293786 13/37 (35%)
ANK repeat 387..420 CDD:293786 12/32 (38%)
ANK repeat 422..452 CDD:293786 15/31 (48%)
Ion_trans 613..812 CDD:459842
ANKRD44NP_001354424.1 ANK 1 7..36 3/11 (27%)
Ank_4 10..61 CDD:372654 10/36 (28%)
ANK repeat 11..38 CDD:293786 3/13 (23%)
ANK repeat 40..71 CDD:293786 10/30 (33%)
ANK 2 40..69 9/28 (32%)
ANKYR 54..343 CDD:440430 98/308 (32%)
ANK 3 73..102 11/28 (39%)
ANK repeat 76..104 CDD:293786 11/27 (41%)
ANK repeat 106..137 CDD:293786 9/36 (25%)
ANK 4 106..135 8/34 (24%)
ANK repeat 139..170 CDD:293786 11/34 (32%)
ANK 5 139..168 11/32 (34%)
ANK repeat 172..203 CDD:293786 12/30 (40%)
ANK 6 172..201 12/28 (43%)
ANK repeat 205..236 CDD:293786 11/30 (37%)
ANK 7 205..234 11/28 (39%)
PHA03095 212..>493 CDD:222980 62/233 (27%)
ANK 8 238..267 12/37 (32%)
ANK repeat 238..266 CDD:293786 11/36 (31%)
ANK repeat 271..302 CDD:293786 15/31 (48%)
ANK 9 271..301 15/30 (50%)
ANK repeat 305..336 CDD:293786 5/30 (17%)
ANK 10 305..334 5/28 (18%)
ANK repeat 338..369 CDD:293786 7/30 (23%)
ANK 11 338..367 6/28 (21%)
ANK repeat 375..420 CDD:293786 11/60 (18%)
ANK repeat 422..453 CDD:293786
ANK 13 422..451
ANK repeat 455..486 CDD:293786
ANK 14 455..484
ANK repeat 488..547 CDD:293786
ANK 15 488..516
ANKYR 510..767 CDD:440430
ANK repeat 549..580 CDD:293786
ANK 16 549..579
ANK repeat 582..615 CDD:293786
ANK 17 584..613
ANK 18 617..646
ANK repeat 618..648 CDD:293786
ANK repeat 651..685 CDD:293786
ANK 19 651..680
ANKYR 668..997 CDD:440430
ANK repeat 687..718 CDD:293786
ANK 20 687..716
ANK repeat 720..751 CDD:293786
ANK 21 720..749
ANK 22 753..782
ANK repeat 789..854 CDD:293786
ANK 23 789..818
ANK 24 821..850
ANK 25 856..885
ANK repeat 857..887 CDD:293786
ANK repeat 889..921 CDD:293786
ANK 26 889..919
ANK repeat 923..954 CDD:293786
ANK 27 923..952
ANK repeat 959..990 CDD:293786
ANK 28 959..988
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.