DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wtrw and Ankrd61

DIOPT Version :9

Sequence 1:NP_731193.1 Gene:wtrw / 40931 FlyBaseID:FBgn0260005 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001037762.1 Gene:Ankrd61 / 689907 RGDID:1586393 Length:418 Species:Rattus norvegicus


Alignment Length:439 Identity:103/439 - (23%)
Similarity:158/439 - (35%) Gaps:133/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 YLWAAYLKRWDLIESLLEAGADLHFCDQNGISALHLSAFSGCLATLGLLVAKGLNVNLQSKCYTP 218
            :|.|.|.|...|: .||:.|||....|..|::.|||..               ||..:.|..:| 
  Rat    80 HLAAEYRKPQSLL-CLLQHGADPEVRDAQGLTTLHLML---------------LNWPVTSTTWT- 127

  Fly   219 LHCAAFGNAAEAAKLLINNGADISKDTSKPNCEESLLHCAVRSNALECLQIFIAEGADVNSLKPN 283
                                        ||:.....:...:::||:.||:|....||.||:...|
  Rat   128 ----------------------------KPSTRIQKILTDIQNNAVLCLRILCDHGAQVNARVDN 164

  Fly   284 GT--NAIHLAADLGNIQCLEALLNAPN-ADANVRICIREKESTALHLAADEGNVECVDLLLAKGA 345
            ..  :.:|||...|....|..|  |.| |..|   .|.|...|.||:|||..|...::.|:|.||
  Rat   165 SNKHSPLHLAITYGTYPVLSFL--AQNGAQVN---AINESSMTPLHMAADILNKNMIETLIACGA 224

  Fly   346 DAKLK-NHRGFTPLHLAARTSSLDCVESLLRNGNADANAEDFDHRTPLHAAVGKSENAYDIMETL 409
            :.... :..|.|.|.||..|:|       .:.|..            |.|.||       .:..|
  Rat   225 NVNCAISSTGNTALKLAVCTAS-------SKAGRL------------LAAGVG-------CIRLL 263

  Fly   410 IQWGANVNHKDIYGFTALHLAALDGLVQCVEMLIFHGADVTTKSKKGTSALNVITRKTPASVAMI 474
            :..||.||.:|..|.||||.|...|....:.:|:...|:|           |::||...:.:.|.
  Rat   264 LNHGAQVNAQDHEGQTALHEACFGGREVIINLLLEFEANV-----------NILTRNGESPIYMY 317

  Fly   475 RQKLDAAITLHHSQDPVNREVELELDFRQLLQHCHPREIS-----------------YLNTFVDE 522
            .|:....           |:|.|   ..:||...:|..:|                 ...|.:..
  Rat   318 LQRSSNI-----------RDVTL---LARLLYRTYPLRLSNKQGALPAGIMLPEFHLLRETLIKL 368

  Fly   523 GQKEILEHPLCSSFLYIKWGKIRKYYIGRL-----------IFCFSFVL 560
            .:|.:....:|...:...:|:..|:.:.:|           |:.|:::|
  Rat   369 SKKPLTLEAICKRNIRNVYGEKYKFQLKKLLPAKLWNSIYGIYDFTYLL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtrwNP_731193.1 Ank_2 156..241 CDD:289560 18/84 (21%)
ANK repeat 182..213 CDD:293786 6/30 (20%)
ANK repeat 215..242 CDD:293786 1/26 (4%)
ANK 216..341 CDD:238125 32/127 (25%)
ANK repeat 250..281 CDD:293786 9/30 (30%)
Ank_2 255..351 CDD:289560 33/99 (33%)
ANK repeat 283..317 CDD:293786 11/36 (31%)
ANK 323..443 CDD:238125 36/120 (30%)
ANK repeat 323..351 CDD:293786 11/28 (39%)
Ank_2 325..420 CDD:289560 27/95 (28%)
ANK repeat 353..385 CDD:293786 8/31 (26%)
ANK repeat 387..420 CDD:293786 9/32 (28%)
Ank_2 392..>460 CDD:289560 20/67 (30%)
ANK repeat 422..452 CDD:293786 10/29 (34%)
Ion_trans 613..812 CDD:278921
Ankrd61NP_001037762.1 ANK 1 27..57
ANK 29..114 CDD:238125 13/34 (38%)
ANK 2 74..103 10/23 (43%)
ANK 78..220 CDD:238125 50/189 (26%)
ANK repeat 78..105 CDD:293786 10/25 (40%)
Ank_2 79..197 CDD:289560 41/166 (25%)
ANK repeat 107..164 CDD:293786 19/100 (19%)
ANK 3 131..160 8/28 (29%)
ANK 164..297 CDD:238125 49/163 (30%)
ANK 4 166..195 10/33 (30%)
ANK repeat 168..197 CDD:293786 10/33 (30%)
Ank_2 171..274 CDD:289560 40/133 (30%)
ANK repeat 199..274 CDD:293786 28/100 (28%)
ANK 5 199..228 11/28 (39%)
ANK 6 233..272 16/64 (25%)
Ank_5 263..316 CDD:290568 19/63 (30%)
ANK repeat 276..305 CDD:293786 10/39 (26%)
ANK 7 276..305 10/39 (26%)
ANK 8 309..342 8/46 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24197
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.