DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wtrw and ankrd54

DIOPT Version :9

Sequence 1:NP_731193.1 Gene:wtrw / 40931 FlyBaseID:FBgn0260005 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001002578.1 Gene:ankrd54 / 436851 ZFINID:ZDB-GENE-040718-318 Length:315 Species:Danio rerio


Alignment Length:140 Identity:50/140 - (35%)
Similarity:70/140 - (50%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GADVNSLKPNGTNAIHLAADLGNIQCLEALLNAPNADANVRICIREKESTALHLAADEGNVECVD 338
            |.|::::|     .:..||:..:|..:..||.    |........:|..||||.::..||...|.
Zfish   120 GKDLHAVK-----RLREAANSNDIDTVRRLLE----DDTDPCAADDKGRTALHFSSCNGNETIVQ 175

  Fly   339 LLLAKGADAKLKNHRGFTPLHLAARTSSLDCVESLLRNGNADANAEDFDHRTPLHAAVGK----S 399
            |||:.|||...::..|.|||||||.|:.:..:.:||| |.|..:|.|...|||||.|..|    .
Zfish   176 LLLSYGADPNQRDSLGNTPLHLAACTNHVPVITTLLR-GGARVDALDRAGRTPLHLARSKLNILQ 239

  Fly   400 ENAYDIMETL 409
            |.....:|||
Zfish   240 EGDSRSLETL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtrwNP_731193.1 Ank_2 156..241 CDD:289560
ANK repeat 182..213 CDD:293786
ANK repeat 215..242 CDD:293786
ANK 216..341 CDD:238125 18/66 (27%)
ANK repeat 250..281 CDD:293786 2/6 (33%)
Ank_2 255..351 CDD:289560 23/76 (30%)
ANK repeat 283..317 CDD:293786 6/33 (18%)
ANK 323..443 CDD:238125 40/91 (44%)
ANK repeat 323..351 CDD:293786 13/27 (48%)
Ank_2 325..420 CDD:289560 38/89 (43%)
ANK repeat 353..385 CDD:293786 15/31 (48%)
ANK repeat 387..420 CDD:293786 11/27 (41%)
Ank_2 392..>460 CDD:289560 8/22 (36%)
ANK repeat 422..452 CDD:293786
Ion_trans 613..812 CDD:278921
ankrd54NP_001002578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
ANK 1 124..153 7/37 (19%)
ANK 129..237 CDD:238125 43/112 (38%)
Ank_2 129..221 CDD:289560 35/96 (36%)
ANK repeat 129..155 CDD:293786 6/29 (21%)
ANK repeat 157..188 CDD:293786 14/30 (47%)
ANK 2 157..186 14/28 (50%)
ANK repeat 190..221 CDD:293786 15/31 (48%)
ANK 3 190..219 14/29 (48%)
BAR 216..>291 CDD:299863 13/34 (38%)
ANK 4 223..255 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.