DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wtrw and Ankrd54

DIOPT Version :9

Sequence 1:NP_731193.1 Gene:wtrw / 40931 FlyBaseID:FBgn0260005 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001365917.1 Gene:Ankrd54 / 223690 MGIID:2444209 Length:307 Species:Mus musculus


Alignment Length:365 Identity:84/365 - (23%)
Similarity:127/365 - (34%) Gaps:122/365 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ESLLEAGADLHFCDQN-------GISALHLSAFSGCLATLGLLVAKGLNVNLQSKCYTPLHCAAF 224
            |.|.|||..:.|.|..       |:....:......|..|.:|..:.:....:.:|..|  ....
Mouse    28 EPLAEAGGLVSFADFGVSLGSGAGLPGRSVGRAQSSLRYLQVLWQQDVEPRDELRCKIP--AGRL 90

  Fly   225 GNAAEAAKLLINNGADISKDTSKPNCEESL--LHCAVRSNALECLQIFIAEGADVNSLKPNGTNA 287
            ..||...:.|...|.::          .:|  |..:..:|.:|.:|..:.:|||           
Mouse    91 RRAARPHRRLGPTGKEV----------HALKRLRDSANANDVETVQQLLEDGAD----------- 134

  Fly   288 IHLAADLGNIQCLEALLNAPNADANVRICIREKESTALHLAADEGNVECVDLLLAKGADAKLKNH 352
             ..|||                         :|..||||.|:..||.:.|.|||..|||...::.
Mouse   135 -PCAAD-------------------------DKGRTALHFASCNGNDQIVQLLLDHGADPNQQDG 173

  Fly   353 RGFTPLHLAARTSSLDCVESLLRNGNADANAEDFDHRTPLHAAVGKSENAYDIMETLIQWGANVN 417
            .|.|||||||.|:.:..:.:||| |.|..:|.|...|||||.|..|    .:|::          
Mouse   174 LGNTPLHLAACTNHVPVITTLLR-GGARVDALDRAGRTPLHLAKSK----LNILQ---------- 223

  Fly   418 HKDIYGFTALHLAALDGLVQCVEMLIFHGADVTTKSKKGTSALNVITRKTPASVAMI-------- 474
                           :|..||:|.:                .|.|.....|.|..:|        
Mouse   224 ---------------EGHSQCLEAV----------------RLEVKQPAAPTSFQIIHMLREYLE 257

  Fly   475 -------RQKLDAAIT---LHHSQDPVNREVELELDFRQL 504
                   |::||...|   :..:::.|:...:|...|..|
Mouse   258 RLGRHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wtrwNP_731193.1 Ank_2 156..241 CDD:289560 17/80 (21%)
ANK repeat 182..213 CDD:293786 4/37 (11%)
ANK repeat 215..242 CDD:293786 6/26 (23%)
ANK 216..341 CDD:238125 26/126 (21%)
ANK repeat 250..281 CDD:293786 8/32 (25%)
Ank_2 255..351 CDD:289560 25/95 (26%)
ANK repeat 283..317 CDD:293786 3/33 (9%)
ANK 323..443 CDD:238125 42/119 (35%)
ANK repeat 323..351 CDD:293786 14/27 (52%)
Ank_2 325..420 CDD:289560 36/94 (38%)
ANK repeat 353..385 CDD:293786 15/31 (48%)
ANK repeat 387..420 CDD:293786 8/32 (25%)
Ank_2 392..>460 CDD:289560 9/67 (13%)
ANK repeat 422..452 CDD:293786 4/29 (14%)
Ion_trans 613..812 CDD:278921
Ankrd54NP_001365917.1 Ank_2 117..205 CDD:403870 39/125 (31%)
ANK repeat 141..172 CDD:293786 15/30 (50%)
ANK repeat 174..205 CDD:293786 15/31 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.