DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArgRS-m and Dalrd3

DIOPT Version :9

Sequence 1:NP_001262351.1 Gene:ArgRS-m / 40929 FlyBaseID:FBgn0037526 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_011241203.1 Gene:Dalrd3 / 67789 MGIID:1915039 Length:545 Species:Mus musculus


Alignment Length:242 Identity:44/242 - (18%)
Similarity:76/242 - (31%) Gaps:75/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 LLYVVDNGQADHFNALFKTTAALDDRLSLEQLQHVKFG--RIYGMSTRQGKAIFLKDVLDEARDI 412
            :::||...:|.....|......||||...:| :|:..|  ::.|:...|                
Mouse   277 VIHVVSCEEAFQQQKLDLLWQKLDDRAPHKQ-KHLVCGPVKMAGVPGTQ---------------- 324

  Fly   413 MREKRNISATTRENYNLDDEHVC---------------------DILGVSAVLVNVLKQRRQRDH 456
                    .|..:.|.|....||                     |||.|:.:...:|....|...
Mouse   325 --------LTAPQYYRLRHAQVCEASALKHGGDLAQDPAWTETFDILSVATIKFEMLSTAPQSQL 381

  Fly   457 EFSWQQALQVNGDTGIKLQYTHCRLHSLLDNFRDVDLDDIKPDWKHFSTEPADALD--LLYALAR 519
            ..:..........:|..:.|...||.:|.:.::......:.|.:...|     :||  ||:    
Mouse   382 LLAHSTISTKGTKSGTFVMYNCARLATLFEGYKHGTEQGLYPTFPLVS-----SLDFSLLH---- 437

  Fly   520 FDQSVWQSKEQLEACVLVNYLFGLCNATSQALK-------RLPVKQE 559
             |:..|        .:|.|.:....:..||.:.       .:||:.|
Mouse   438 -DEGEW--------LLLFNSVLPFLDLLSQTVSLAGTPGLHIPVRTE 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgRS-mNP_001262351.1 ArgS 67..594 CDD:223097 44/242 (18%)
nt_trans 137..397 CDD:294020 12/48 (25%)
Anticodon_Ia_like 436..594 CDD:299868 26/133 (20%)
Dalrd3XP_011241203.1 DALR_1 399..>499 CDD:214846 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.