DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArgRS-m and Dalrd3

DIOPT Version :9

Sequence 1:NP_001262351.1 Gene:ArgRS-m / 40929 FlyBaseID:FBgn0037526 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001014236.1 Gene:Dalrd3 / 363146 RGDID:1359206 Length:538 Species:Rattus norvegicus


Alignment Length:238 Identity:44/238 - (18%)
Similarity:72/238 - (30%) Gaps:90/238 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 TTRENYNLDDEHVC---------------------DILGVSAVLVNVLKQRRQRDHEFSWQQALQ 465
            |..|.:.|....||                     |||.|:.:...:|....|.....:......
  Rat   326 TAPEYHRLRHAQVCKASAQKHGGDLAQDPAWTETFDILSVATIKFEMLSTAPQGQLLLAHSTIST 390

  Fly   466 VNGDTGIKLQYTHCRLHSLLDNFRDVDLDDIKPDWKH------FSTEP-ADALD--LLYALARFD 521
            ....:|..:.|...||.:|.:.:            ||      :.|.| ..:||  ||:     |
  Rat   391 KGTKSGTFVMYNCARLATLFEGY------------KHGMEQGLYPTFPLVSSLDFSLLH-----D 438

  Fly   522 QSVWQSKEQLEACVLVNYLFGLCNATSQALK-------RLPVKQESSLEKQLQ------------ 567
            :..|        .:|.|.:....:..||.:.       .:||:.|...:..:|            
  Rat   439 EGEW--------LLLFNSVLPFLDLLSQTVSLASTPGLHIPVRTEMVCKFLVQLSMDFSSYYNRV 495

  Fly   568 ----------------RLLLFHAAKKTLRHGMELLGLRPLNQM 594
                            ||.|..|.::....|:.:|||.||:.:
  Rat   496 HILGEPRPHLFGQMFARLQLLRAVREVFHTGLAMLGLPPLSHI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgRS-mNP_001262351.1 ArgS 67..594 CDD:223097 44/236 (19%)
nt_trans 137..397 CDD:294020
Anticodon_Ia_like 436..594 CDD:299868 39/201 (19%)
Dalrd3NP_001014236.1 DALR_1 399..538 CDD:214846 32/163 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.