DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18268 and CG3014

DIOPT Version :10

Sequence 1:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_649738.1 Gene:CG3014 / 40922 FlyBaseID:FBgn0037519 Length:488 Species:Drosophila melanogaster


Alignment Length:326 Identity:74/326 - (22%)
Similarity:138/326 - (42%) Gaps:78/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPINCEFNLSRAAAIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHWRESLRGPPEIEH 65
            ||..|.|.|.|...:|.:||.|||.:.:..|..|  ::..|.|||.|.:.|.|  |:.|..|   
  Fly     1 MPTTCVFQLDRLNPVYNSGEYISGRILLRTDKVK--RVNAVYVTLEGEAKVQW--SMSGKSE--- 58

  Fly    66 NDSTGNLECPKVDYNGSKVHINETKKLNEVLQLENGTFRLG----DFNFQLPENLPATCRLPFGN 126
               |.|       |:|.:.:::....:     .:|..||.|    ....::|.:.|:||:.|:|.
  Fly    59 ---TAN-------YSGHQQYLHSRTNV-----FDNTLFRAGVHVYVLTLRIPPDCPSTCKGPYGY 108

  Fly   127 VEYVLKVVLERRGTHNKCFQQRLVIRKCVEL------------ADLK-----PQYMETANMGLTL 174
            :.|.:.:.:::....::.|::.:::.:.::|            .:||     |.........|||
  Fly   109 IAYTISLTIDKPWGFDEVFRKPIIVVQTLDLNYNAEFSLPVKDENLKYLCHWPCISGPICSTLTL 173

  Fly   175 PRSVFVPGQSVSY--EICSKDGVQDFL---TRLCKKISYTSQQP-----SAKTKNVTQVLSESS- 228
            |.|.|.|.|.|.|  |:.::....|.:   ..:.:...:.|::|     .:||. |.:::|:.: 
  Fly   174 PASGFTPLQEVPYRLEVDNQSPHYDIIGVEVSIKQHFVFLSRKPVKRNFYSKTL-VKELISDRTL 237

  Fly   229 -----ELNGNLRLPLTAPIMSHSDQLDPIQISYYIETFNSLNAPIK-----------VPIFVATV 277
                 :...::.:|:..|    ...|:|   :|.:....:|...:|           |||.|.|.
  Fly   238 RLSKRQYESSICVPMDTP----RSTLNP---NYIVFLHYTLQVKLKTGYFHYDTDLSVPIIVGTT 295

  Fly   278 A 278
            :
  Fly   296 S 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18268NP_649739.1 Arrestin_N 5..153 CDD:451447 38/151 (25%)
Arrestin_C 172..279 CDD:460676 30/134 (22%)
CG3014NP_649738.1 Arrestin_N 5..140 CDD:451447 38/156 (24%)
Arrestin_C 164..294 CDD:214976 29/137 (21%)

Return to query results.
Submit another query.