DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18268 and CG2641

DIOPT Version :10

Sequence 1:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_649737.1 Gene:CG2641 / 40921 FlyBaseID:FBgn0037518 Length:429 Species:Drosophila melanogaster


Alignment Length:338 Identity:79/338 - (23%)
Similarity:139/338 - (41%) Gaps:86/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPINCEFNLSRAAAIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHW---RESLRGPPE 62
            ||.:|.|.|.|...|||:||.::|...:|...:||  :..|.:...|.:.|.|   |...||   
  Fly     1 MPSSCSFELDRREPIYYSGETVNGRAILTTTSEKS--VNEVYILFEGEAKVRWDERRTRTRG--- 60

  Fly    63 IEHNDSTGNLECPKVDYNGSKVHINE-TKKLNEVLQLENGTFRLGD-------FNF--QLPENLP 117
                              |...|..| .:...:.|......|..|:       :||  .||...|
  Fly    61 ------------------GKTEHYTEYFRGKQQYLYTRTSVFGSGNLPPGTHTYNFCIPLPLECP 107

  Fly   118 ATCRLPFGNVEYVLKVVLERRGTHNKCFQQRLVIRKCVELADLKPQYME-------------TAN 169
            ::....:|.:.|.:.||::|:...|..|:|.|.:.:...| ::.||.:.             ..:
  Fly   108 SSVVAQYGKIFYEVSVVIDRQWRFNNVFKQPLTVIQTYNL-NMSPQLLMPLVREDIKHFCCWPCS 171

  Fly   170 MG-----LTLPRSVFVPGQSVSY--EICSK------DGVQDFLTRLCKKISYTSQQPSAKTKNVT 221
            .|     ||:|...:.|||.:.:  ||.::      :|::..|.::.|   :.:|.|..||:...
  Fly   172 SGPVLSTLTIPFGGYAPGQKIRFTLEIDNQSSGYDLNGIELKLKQIYK---FQAQTPHHKTREKE 233

  Fly   222 QVLSES-----------SELNGNLRLPLTAPIMSHSDQLDPIQISY-YIETFNS----LNAPIKV 270
            ..|::|           .::.|.|.:|...| .|.::.:  |.:|| .|.|.::    :::..:|
  Fly   234 HSLNKSCQQERVLRLSKKKIEGTLAIPAVPP-SSRTEGI--ISVSYQVILTISTGDCHVDSDFEV 295

  Fly   271 PIFVATVAPPVNS 283
            ||.:.|: |.:.|
  Fly   296 PIVIGTI-PLIQS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18268NP_649739.1 Arrestin_N 5..153 CDD:451447 40/160 (25%)
Arrestin_C 172..279 CDD:460676 31/130 (24%)
CG2641NP_649737.1 Arrestin_N 5..148 CDD:425619 41/166 (25%)
Arrestin_C 171..304 CDD:460676 32/139 (23%)

Return to query results.
Submit another query.