DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18268 and ZK938.11

DIOPT Version :10

Sequence 1:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:111 Identity:19/111 - (17%)
Similarity:43/111 - (38%) Gaps:31/111 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNLSRAAAIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHWRESLRGPPEIEHNDSTG 70
            ||.:...:.:.|....|..::::.||..                   |:.:|:...|:       
 Worm    40 EFQIPTGSRLTYKAGHIKYTMSLEVDRP-------------------WKTNLKVKKEV------- 78

  Fly    71 NLECPKVDYNGSKVHINETKKLNEVLQLENGTFRLGDFNFQLPENL 116
             :...|:|.:  :|:..|.|.::....:  |.|::|....:||.::
 Worm    79 -IVARKLDVD--EVYFTENKTVSNKPAI--GVFQMGSSTSRLPPHV 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18268NP_649739.1 Arrestin_N 5..153 CDD:451447 19/111 (17%)
Arrestin_C 172..279 CDD:460676
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 10/72 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.