DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18268 and arrd-12

DIOPT Version :10

Sequence 1:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001309576.1 Gene:arrd-12 / 187636 WormBaseID:WBGene00011053 Length:186 Species:Caenorhabditis elegans


Alignment Length:136 Identity:35/136 - (25%)
Similarity:60/136 - (44%) Gaps:14/136 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHWRESLRGPPEIEHNDSTGNLECP--K 76
            |:|..|::|||.:..:...:::.:  .:.|.|||.|...:   .|...|.:.| |.|..|..  .
 Worm    13 AVYAAGQKISGRVVFSTASQQNPR--WIDVQLHGRSHTFF---TRQESETKTN-SKGESETKTHT 71

  Fly    77 VDYNGSKVHINET----KKLNEVLQLENGTFRLGDFNFQLP-ENLPATCRLPFGNVEYVLKVVLE 136
            |.|..:..|::..    :|.::..:|..|.:. ..|.|||| ..||.:.....||:.|.::..:.
 Worm    72 VHYTATAKHLDTAVPLWRKTDKAARLLPGKYE-WQFWFQLPCSVLPPSFEGNNGNIRYWVRAEVS 135

  Fly   137 RRGTHN 142
            |....|
 Worm   136 RSWKFN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18268NP_649739.1 Arrestin_N 5..153 CDD:451447 35/136 (26%)
Arrestin_C 172..279 CDD:460676
arrd-12NP_001309576.1 Arrestin_N 6..157 CDD:451447 35/136 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.