DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3014 and ZK938.11

DIOPT Version :10

Sequence 1:NP_649738.1 Gene:CG3014 / 40922 FlyBaseID:FBgn0037519 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:48 Identity:18/48 - (37%)
Similarity:29/48 - (60%) Gaps:2/48 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RIPPDCPSTCKGPYGYIAYTISLTIDKPWGFDEVFRKPIIVVQTLDLN 140
            :||.....|.|.  |:|.||:||.:|:||..:...:|.:||.:.||::
 Worm    42 QIPTGSRLTYKA--GHIKYTMSLEVDRPWKTNLKVKKEVIVARKLDVD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3014NP_649738.1 Arrestin_N 5..140 CDD:451447 18/46 (39%)
Arrestin_C 164..294 CDD:214976
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.