DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2641 and ZK938.11

DIOPT Version :10

Sequence 1:NP_649737.1 Gene:CG2641 / 40921 FlyBaseID:FBgn0037518 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:85 Identity:22/85 - (25%)
Similarity:38/85 - (44%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YTEYFRGKQQYLYTRTSVFGSGNLPPG--THTYNFCIPLPLECPSSVVAQYGKIFYEVSVVIDRQ 128
            |..||:   :.....||..|...||..  ..::.|.||    ..|.:..:.|.|.|.:|:.:||.
 Worm    10 YETYFK---RSAIVWTSKDGKNKLPVELLEKSFEFQIP----TGSRLTYKAGHIKYTMSLEVDRP 67

  Fly   129 WRFNNVFKQPLTVIQTYNLN 148
            |:.|...|:.:.|.:..:::
 Worm    68 WKTNLKVKKEVIVARKLDVD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2641NP_649737.1 Arrestin_N 5..148 CDD:425619 22/83 (27%)
Arrestin_C 171..304 CDD:460676
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.