DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2641 and rnh-1.2

DIOPT Version :10

Sequence 1:NP_649737.1 Gene:CG2641 / 40921 FlyBaseID:FBgn0037518 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_496121.2 Gene:rnh-1.2 / 191471 WormBaseID:WBGene00014163 Length:192 Species:Caenorhabditis elegans


Alignment Length:96 Identity:24/96 - (25%)
Similarity:31/96 - (32%) Gaps:30/96 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RREPIYYSGETVN--------GRAILTTTSE-----------KSVNEVY---ILFEGEAKVR-WD 52
            |...:|..|.|||        |.||:.....           |..|.||   .::|....|| ||
 Worm     4 RYREVYTDGSTVNNGKRGARGGWAIVFPFDRSLDEYDFMKVGKQTNNVYELTAIYEATEVVRCWD 68

  Fly    53 ERRTRTRGGKTEHYTEYFRGKQQYLYTRTSV 83
                   ..|.....|:.|.|.....|.:|:
 Worm    69 -------SFKCNQKLEFVRLKNTITPTTSSI 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2641NP_649737.1 Arrestin_N 5..148 CDD:425619 24/96 (25%)
Arrestin_C 171..304 CDD:460676
rnh-1.2NP_496121.2 RNase_H_like 8..167 CDD:449355 23/92 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.