DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and ECM21

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_009449.1 Gene:ECM21 / 852173 SGDID:S000000197 Length:1117 Species:Saccharomyces cerevisiae


Alignment Length:365 Identity:65/365 - (17%)
Similarity:114/365 - (31%) Gaps:152/365 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NPKKR----------SKHQYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHC---- 115
            |||:|          :|.::...||....|..::     ..:.:||    || :.|.|.|.    
Yeast   714 NPKERLGITEPIIIETKLKFPKYEDLDKRTAKII-----PPYGIDA----YT-SIPNPEHAVANG 768

  Fly   116 PSSFEGAYGHIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHT 180
            ||.        |..:.:.||.....:::|            .:..|.:.:|..::.:        
Yeast   769 PSH--------RRPSVIGFLSGHKGSKSH------------EENEKPVYDPKFHQTI-------- 805

  Fly   181 KPVQLKVTLQQQGYVPGQFMLIHAHVR-------------NDSSSDCR-KLLIMLHL-------- 223
                    ::....:|     :..|.|             :.|:..|| ||.|||.:        
Yeast   806 --------IKSNSGLP-----VKTHTRLNTPKRGLYLDSLHFSNVYCRHKLEIMLRISKPDPECP 857

  Fly   224 ----RATYTADTPSLRTTSEKIMLVKRECG---------------------PVAHNAQ------- 256
                ......|||        |.||..:|.                     |::.|:.       
Yeast   858 SKLRHYEVLIDTP--------IFLVSEQCNSGNMELPTYDMATMEGKGNQVPLSMNSDFFGNTCP 914

  Fly   257 --RTYTETLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATAVSGPD 319
              .|:.|.:.:||:.......|..:..||:..::::...              |:...|:|||  
Yeast   915 PPPTFEEAISVPASPIVSPMGSPNIMASYDPDLLSIQQL--------------NLSRTTSVSG-- 963

  Fly   320 FLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGY 359
                   |||.|..|.:|..:..::..|......:|||.:
Yeast   964 -------PSGYSDDAGVPNVNRNSISNANAMNGSISNSAF 996

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 21/105 (20%)
Arrestin_C 179..308 CDD:280848 27/184 (15%)
ECM21NP_009449.1 Arrestin_C 585..>648 CDD:214976
Arrestin_C <781..878 CDD:413500 20/137 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.