DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and ART10

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_013496.3 Gene:ART10 / 851108 SGDID:S000004384 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:54/248 - (21%)
Similarity:86/248 - (34%) Gaps:88/248 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDQNEHGTYFTGQVITGKVIVNLNK-------TKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNP 66
            |..|..|    ..::|.....|.:.       .|.:.|:     ||.::. |......::.|:|.
Yeast   225 FSNNSRG----NSMVTNNEFFNSSNLKVPSKDVKVVNGV-----GYIKSD-RNFSQANSILIENG 279

  Fly    67 KKRSKHQYSGREDYIAST---------------TYLMGSEQG-SNFNMDAGT--------YTYTF 107
            ..||:...|     :.||               ||.||...| ||..::..:        ..|.|
Yeast   280 DIRSRPVSS-----VTSTRQSTRLVNGMKVFPSTYKMGLPDGESNMRIEVRSRDLKQIYRKDYLF 339

  Fly   108 ACPIPSHCPSSFEGAY----GHIRYLAKV---------------TFLKPGASNRTHNVGFTVLKL 153
            ...     ..:|:..|    |:|..|:|:               |:|..|.:|.    .::.|||
Yeast   340 RSG-----SQNFDKVYVVMEGNIASLSKMQITPLKLQLNLLETTTYLSQGIANG----NYSSLKL 395

  Fly   154 --LDLNQ--ETKMLREPASNEAVEHF------CLMHTK--PVQLKVTLQQQGY 194
              :||||  ..|.|.:  .||..|:|      |.:..|  |:..|:...::.|
Yeast   396 IEIDLNQLKSNKPLLD--LNEIRENFDGSMFECELRLKDHPILRKLVFNEEDY 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 40/199 (20%)
Arrestin_C 179..308 CDD:280848 4/18 (22%)
ART10NP_013496.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.