DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and ROG3

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_116677.3 Gene:ROG3 / 850578 SGDID:S000001918 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:82/484 - (16%)
Similarity:161/484 - (33%) Gaps:163/484 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRR----HGKAVAIQNPKKRS------------ 70
            :::|.:::::|:..:::.|.|::.|..|....:.|    ...:::...||.|.            
Yeast    41 LLSGCIVLSINEPMQIKSISLRLYGKIQIDVPLERPQDASSSSLSSSPPKIRKYNKVFYNYAWDN 105

  Fly    71 ---KHQYSG---------------------REDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPI 111
               |...||                     |....:|...|.||...|:..:|.|.|.:.|:..:
Yeast   106 VNLKEYLSGLRGQSGLAGSSSSSNILGTRQRAQSTSSLKSLKGSSSPSSCTLDKGNYDFPFSAIL 170

  Fly   112 PSHCPSSFEGAYGHIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLR--EPASNEAVEH 174
            |...|.|.|....     ..||:.......|:.|....:.:     :..::||  .||:.|..|.
Yeast   171 PGSLPESVESLPN-----CFVTYSMESVIERSKNYSDLICR-----KNIRVLRTISPAAVELSET 225

  Fly   175 FCLMHTKPVQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSE 239
            .|:.::.|.::..::.    ||.:.:.|      .|::.....::.|         :..|:..|.
Yeast   226 VCVDNSWPDKVDYSIS----VPNKAVAI------GSATPINISIVPL---------SKGLKLGSI 271

  Fly   240 KIMLVK--RECGP----VAHNAQRT--------------------------------------YT 260
            |::|.:  :.|.|    ::.|.|.|                                      ..
Yeast   272 KVVLFENYQYCDPFPPVISENRQVTELNLEDPLNESSGEFNGNGCFVNNPFFQPDHSFQDKWEID 336

  Fly   261 ETLRIPATAPTCEHLSKV---VRVSYEVRVVAVMNWLMANP-------RLIIPVTIGNVPLATAV 315
            ..|:||.:...|.....|   ::|.::::...:    :.||       |..:|:.:...|     
Yeast   337 TILQIPNSLSNCVQDCDVRSNIKVRHKLKFFII----LINPDGHKSELRASLPIQLFISP----- 392

  Fly   316 SGPDFLPTNAFPSGSSLPADLPCT-------STRAMELAQMAASGVSNSGYEMAEDLEDFELPED 373
                |:..:..|..||....|..|       |::..|...:.:...|.:|.|:..|:.       
Yeast   393 ----FVALSIKPLSSSNLYSLFSTTNQKDENSSQEEEEEYLFSRSASVTGLELLADMR------- 446

  Fly   374 GDDELEAADDFVPD----LPPPTYEQAMF 398
                   :...||.    :.||.||..::
Yeast   447 -------SGGSVPTISDLMTPPNYEMHVY 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 31/174 (18%)
Arrestin_C 179..308 CDD:280848 25/182 (14%)
ROG3NP_116677.3 Arrestin_N <156..215 CDD:419887 14/68 (21%)
Arrestin_C 232..393 CDD:214976 26/192 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343424
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.