DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and arrdc2

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_012821263.1 Gene:arrdc2 / 780156 XenbaseID:XB-GENE-946088 Length:418 Species:Xenopus tropicalis


Alignment Length:451 Identity:92/451 - (20%)
Similarity:171/451 - (37%) Gaps:92/451 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSKHQYSGRE 78
            |..|..|:::.|||::.|.|..::..:::...|.|...|.             :.||....:...
 Frog    36 HKVYSAGEIVEGKVVLELCKELRVSALEVCGRGLATVHWL-------------ESRSVGMNTVYS 87

  Fly    79 DYIASTTYL-----MGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVTFLKPG 138
            |:.:..|||     :..:.|:...:.||.:.:.|:..:|....:||||.:|.:||..|....:|.
 Frog    88 DFTSYETYLRKRQHLIRDNGTLTMLPAGRHEFPFSFQLPETLVTSFEGKHGSVRYWVKAKLHRPW 152

  Fly   139 ASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVTLQQQGYVPGQFMLIH 203
            .:.:.....|||::.:|:|....:..:..|.|.:.|....:...|.:...:.::||.||:.:.|.
 Frog   153 CTVKKVKKEFTVIEPIDINTPDLLAPQAGSKEKIAHAWYCNLGHVSVTAKIDRKGYTPGEVIPIF 217

  Fly   204 AHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRECGPVAHNAQRT--YTETLRIP 266
            |.:.|     |....::.......:....:..|..:|..:|....|......:|.  :...|:||
 Frog   218 AEIDN-----CTTRAVIPKAAIIQSQAFVARGTMKQKKSVVATLAGDAVPAGKRETWHGRALKIP 277

  Fly   267 ATAPT---CEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATAVSGPDFLPTNAFPS 328
            ...|:   |    :::||.|.::|...:.. .:|..|.:|:.||.:||              .|.
 Frog   278 PLGPSILQC----RIIRVEYTLKVCVEIPG-SSNLVLELPLVIGTIPL--------------HPF 323

  Fly   329 GSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLEDFELPEDGDDELEAADDFVPDLPPPTY 393
            ||.                      .|:.|.:.:.:||...:.             ||:.|.|..
 Frog   324 GSR----------------------TSSVGSQYSVNLEWLRMT-------------VPEQPEPPP 353

  Fly   394 EQAMFMTTDIADTDANTVSEASRFT----PRYPVFDVDTFQSPP------PNPPQKKRRRR 444
            :.:..::.:.|:.:.:....:|...    |.|........:.||      ||||....|.|
 Frog   354 DYSSVVSEEEAEHNLSPPHHSSMGCLLEGPFYAYIQEFRNRPPPLYSEVDPNPPTADIRPR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 35/147 (24%)
Arrestin_C 179..308 CDD:280848 27/133 (20%)
arrdc2XP_012821263.1 Arrestin_N 36..171 CDD:334019 35/147 (24%)
Arrestin_C 195..320 CDD:214976 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8042
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm9421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.