DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and CG18747

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_652650.2 Gene:CG18747 / 59143 FlyBaseID:FBgn0042104 Length:418 Species:Drosophila melanogaster


Alignment Length:467 Identity:142/467 - (30%)
Similarity:231/467 - (49%) Gaps:98/467 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKNCMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQN 65
            |...|.|:||.|:|||::.||::.|...:..:::|:::.:.|::.||:..:|..:..|       
  Fly     1 MVVTCEISFDNNKHGTFYAGQLVKGCATLKCDRSKEVQAVLLKVVGYSITKWSEKSLG------- 58

  Fly    66 PKKRSKHQYSGREDYIASTTYLMGSEQGSNFN------MDAGTYTYTFACPIPSHCPSSFEGAYG 124
                |...|.|||||::|.|||:||||.:..|      ::||.::|.|.|.:|..|||||||.:|
  Fly    59 ----STKLYVGREDYLSSNTYLVGSEQNNTHNNTHRLTIEAGVHSYNFTCQLPYQCPSSFEGRHG 119

  Fly   125 HIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCL--MHTKPVQLKV 187
            .|||:.||..::|...::.:..||||||:||||.:|..|:..|.:|....||.  ..|.|::|::
  Fly   120 CIRYIVKVLLIRPWKFDQAYTKGFTVLKMLDLNFDTPQLKSAAHSEGYRTFCCGPCKTDPLKLEL 184

  Fly   188 TLQQQGYVPGQFMLIHAHVRNDSS---SDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRECG 249
            .|.|.||||||.:.:...|.|:::   |:.|..|:||   ..|.:.:|. .:..|::::.:.:..
  Fly   185 HLPQAGYVPGQKIPVTIVVVNNTAVAVSEIRLSLVML---VRYYSVSPE-HSRVERLIISRAKGE 245

  Fly   250 PVAHNAQRTYTETLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATA 314
            .|.....|:.|..|.:|:|.|||..||.:::::|::.|.|::..|.....:::|||:|.:|||.:
  Fly   246 SVLKQCTRSQTIDLPVPSTPPTCVELSNLIQIAYQLEVEALVKSLREQQLMVMPVTVGTIPLAVS 310

  Fly   315 -------------VSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLE 366
                         ..|||        |..:.|.:||                       |...||
  Fly   311 GIVVQQPPRRSAHYEGPD--------SRRNPPDELP-----------------------MVTALE 344

  Fly   367 DFELPEDGDDELEAADDFVPDLPPPTYEQAMFMTTDIADTDANTVSE-------ASRFTPRYPVF 424
              .||.|...  .|||..:|:     ||::       ..|....::|       ::.|.|.|||:
  Fly   345 --SLPSDLAS--SAADSALPN-----YEES-------RHTQRGNINEEELHAFGSNEFAPLYPVY 393

  Fly   425 DVDTFQSPPPNP 436
            .:     |.|.|
  Fly   394 SI-----PSPTP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 61/157 (39%)
Arrestin_C 179..308 CDD:280848 39/131 (30%)
CG18747NP_652650.2 Arrestin_N 5..152 CDD:278754 61/157 (39%)
Arrestin_C 176..307 CDD:214976 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464040
Domainoid 1 1.000 139 1.000 Domainoid score I9790
eggNOG 1 0.900 - - E1_KOG3780
Homologene 1 1.000 - - H119234
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
1110.900

Return to query results.
Submit another query.