DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and CG18746

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster


Alignment Length:478 Identity:137/478 - (28%)
Similarity:216/478 - (45%) Gaps:69/478 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKR 69
            |.|.|..|..|.::.||:|:|:|::...|.|.::.:.|.|.|||:..|....|       :|..:
  Fly     4 CEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEH-------DPDDQ 61

  Fly    70 SK-HQYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVT 133
            |. ..::|..||:|:..||.||.......::.||.:|.|||.:|..|||||||..|.||||..|.
  Fly    62 SNGESFNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVR 126

  Fly   134 FLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLM--HTKPVQLKVTLQQQGYVP 196
            |::|...:...|..|||:|::|||.|:.|||.|:..|:...||..  .:.|:.:::::.|.|:||
  Fly   127 FVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCCFPCRSSPLSMRLSVPQSGFVP 191

  Fly   197 GQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRECGPVAHNAQRTYTE 261
            ||.:.:...|.|||......:.:.|.:...|.:..||..|..::..:|.:..|.|:...::.:|.
  Fly   192 GQIVPVEVMVSNDSGVAVEDITVKLTMVVIYYSQPPSADTNKDRFEMVLKTGGGVSTKCRQQFTF 256

  Fly   262 TLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATAVSGPDFLPTNAF 326
            .|::|.|.|||.:|..::::.|:|...|.:........|.:|:|||:|||...:...        
  Fly   257 DLKVPPTPPTCFNLCSIIQIGYQVEAEARVKGCHGGQSLHMPITIGSVPLTKQLQKE-------- 313

  Fly   327 PSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEM-AEDLEDFELPEDGDDELEAADDFVPDLPP 390
                      |.|....:...|:.|..:...|.|. .|.|        |.....|||   |.:.|
  Fly   314 ----------PRTWGEVLPPQQLDAKALILIGSEQNGEAL--------GSPNPWAAD---PSIAP 357

  Fly   391 PTYEQAMFMTTD------------------IADTDANTVSEASRFTPRYPVFDVDTFQSPPPNPP 437
            |:|.:|..::.|                  ..:..|.|:.    |:|.|.|||:.       |..
  Fly   358 PSYAEAKHISPDPHKFSKSKKKSQKRGVKGSQERKAETIV----FSPLYAVFDLS-------NQV 411

  Fly   438 QKKRRRRRRRPADPGQSKQQPEK 460
            .:...|......|.|...:..||
  Fly   412 DEMTLRANEPKTDGGYVNEGVEK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 57/152 (38%)
Arrestin_C 179..308 CDD:280848 34/128 (27%)
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 57/152 (38%)
Arrestin_C 174..306 CDD:214976 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464043
Domainoid 1 1.000 139 1.000 Domainoid score I9790
eggNOG 1 0.900 - - E1_KOG3780
Homologene 1 1.000 - - H119234
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
1110.900

Return to query results.
Submit another query.