DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and CG18746

DIOPT Version :10

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster


Alignment Length:228 Identity:46/228 - (20%)
Similarity:73/228 - (32%) Gaps:71/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MPECKF-----GINDKITIEGKSKPGSDDPNK----ASRAAVAIDDCQFHQCVKLTKFETEHAIS 268
            ||..:|     .:|| |..|..|..|..||::    .:|..||.|        ::....||..|.
  Fly    17 MPLARFYYADSALND-IASELDSFDGRRDPDRCNALVTRLRVAQD--------RVLHIITEMLIH 72

  Fly   269 FIPPDGEYELMRYRTTKDIQLPFRVIPLVREVSRNKMEVKVVVKSNFKPSLLAQKLEVRIPTPPN 333
            ..|.:.:      |..:|.::.|                         |.      |:...|.|.
  Fly    73 LYPREQD------RACRDFRVKF-------------------------PD------EILHDTLPG 100

  Fly   334 TSGVQLICMKGKAKYKAGENAIVWK-----IKRMAGMKESQISAEIDLLSTGNVEKKKWNRPPVS 393
            .......|:      .||.|.|..:     |:.:|.....|:....|||...::.......|.:.
  Fly   101 QLWFGAECL------SAGSNIIDHETESDLIRPLAKDVTKQLDFLRDLLKNQSLRDPSAYNPVIK 159

  Fly   394 MN---FEVPFAPSGLKVRYLKVFEPKLNYSDHD 423
            .|   |:..||.  .:.:|:....|..:..:||
  Fly   160 ENLLKFDKLFAE--FEYQYVSAMVPVKSVKEHD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:425619
Arrestin_C 180..311 CDD:214976 22/106 (21%)
CG18746NP_652649.1 Arrestin_N 4..150 CDD:425619 37/184 (20%)
Arrestin_C 174..306 CDD:214976 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.