DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and ARRDC3

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_065852.1 Gene:ARRDC3 / 57561 HGNCID:29263 Length:414 Species:Homo sapiens


Alignment Length:424 Identity:99/424 - (23%)
Similarity:179/424 - (42%) Gaps:65/424 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNCMITFD---QNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQW-RIRRHGKAVA- 62
            |:..|:||   .:....|.:|..::|:|.:.:....:::.:|:...|:|:.:| ..|..|...| 
Human     7 KSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTAY 71

  Fly    63 IQNPKKRSKHQYSGREDYIASTTYLMG-------SEQGSNFNMDAGTYTYTFACPIP-SHCPSSF 119
            .||        |:...:|......|:|       ||:|.: .:.:|.:.|.|:..:| :...:||
Human    72 TQN--------YTEEVEYFNHKDILIGHERDDDNSEEGFH-TIHSGRHEYAFSFELPQTPLATSF 127

  Fly   120 EGAYGHIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFC--LMHTKP 182
            ||.:|.:||..|....:|..........|||.:.:|:|  |..|..|.:....:..|  ...:.|
Human   128 EGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDIN--TPSLLSPQAGTKEKTLCCWFCTSGP 190

  Fly   183 VQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRE 247
            :.|...::::||.||:.:.|.|.:.|.||........:...:|.|...  .::...:.:..::.|
Human   191 ISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKG--KMKEVKQLVANLRGE 253

  Fly   248 CGPVAHNAQRTYT---ETLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNV 309
                :.::.:|.|   :.|:||..:|:....| ::||.|.:.|...:...| :..|.:|:.||.:
Human   254 ----SLSSGKTETWNGKLLKIPPVSPSILDCS-IIRVEYSLMVYVDIPGAM-DLFLNLPLVIGTI 312

  Fly   310 PL------ATAVSGPDFLPTN----AFPSGSSLP---ADLPCTSTRAMELAQMAASGVSNSGYEM 361
            ||      .::||....:..|    :.|.....|   |::.....|...||.::|          
Human   313 PLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYAEVVTEEQRRNNLAPVSA---------- 367

  Fly   362 AEDLEDFELPEDGDDELEAADDFVPDLPPPTYEQ 395
               .:|||....|  .|.|.......||||.|.:
Human   368 ---CDDFERALQG--PLFAYIQEFRFLPPPLYSE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 40/164 (24%)
Arrestin_C 179..308 CDD:280848 29/131 (22%)
ARRDC3NP_065852.1 Arrestin_N 22..165 CDD:334019 37/151 (25%)
Arrestin_C 187..314 CDD:214976 30/134 (22%)
PPxY motif 1. /evidence=ECO:0000305 346..349 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 391..394 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm8525
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.